blob: 51f40b8ebadcfae2a1ead80b2c10df21f5306f72 [file] [log] [blame]
// generated by go run gen.go; DO NOT EDIT
package publicsuffix
const version = "publicsuffix.org's public_suffix_list.dat, git revision 792f13d38c795cf910de96de4baac48f1fee3162 (2021-08-23T07:37:32Z)"
const (
nodesBitsChildren = 10
nodesBitsICANN = 1
nodesBitsTextOffset = 15
nodesBitsTextLength = 6
childrenBitsWildcard = 1
childrenBitsNodeType = 2
childrenBitsHi = 14
childrenBitsLo = 14
)
const (
nodeTypeNormal = 0
nodeTypeException = 1
nodeTypeParentOnly = 2
)
// numTLD is the number of top level domains.
const numTLD = 1508
// Text is the combined text of all labels.
const text = "9guacuiababia-goracleaningroks-theatree164-balsfjordd-dnshome-we" +
"bserverdal-o-g-i-n4t3l3p0rtashkentatamotorsitestinggfarmerseinea" +
"stasiaetnaamesjevuemielnoboribetsucks3-ap-northeast-2ix4432-bals" +
"an-suedtirolkuszczytnoopencraftrainingdyniabruzzoologicalabamaga" +
"sakishimabaraogashimadachicagoboats3-ap-northeast-1kappchizip611" +
"6-b-datacentermezproxyzgorabogadobeaemcloud-fr1337birdartcenterp" +
"risecloudaccesscambridgeiseiroumuencheninohekinannestaditchyouri" +
"parachutingleezebirkenesoddtangenovaranzanquannefrankfurtcmember" +
"s3-website-ap-southeast-2birthplacebitbucketrzyninomiyakonojorpe" +
"landivtasvuodnakamagayahooguyurihonjournalistjohnirasakin-vpncas" +
"inord-odalombardynalias3-website-eu-west-1bjarkoyusuharabjerkrei" +
"mbamblebesbyenvironmentalconservationionjukudoyamaintenancebizen" +
"akanojohanamakinoharaustinnaumburgjerdrumcpeatonsbergjerstadotsu" +
"ruokakamigaharamswatch-and-clockerevistarnbergivestbytemark12bju" +
"gnieznord-frontierblackfridayusuisservehttpbin-butterbloombergba" +
"uernishiazaincheonishigovtcp4bloxcms3-website-sa-east-1bluebitem" +
"p-dnswedenishiharabmoattachments3-website-us-east-1bms3-website-" +
"us-west-1bmwedeployuufcfanishiizunazukindianapolis-a-bloggerbnrw" +
"egroweibolognagareyamakeuparaglidinglitcheltenham-radio-opensoci" +
"alomzaporizhzhegurindianmarketingliwicebomloabathsbcateringebuil" +
"dingloboavistanbulsan-sudtirolondonetskaratsuginamikatagamilanos" +
"hiroomglogoweirbondigitaloceanographicsxboxfordellogliastradingl" +
"oppenzaolbia-tempio-olbiatempioolbialystokkeliwebhostinglugsjcbn" +
"pparibashkiriabonnishikatakazakindielddanuorrindigenaklodzkodair" +
"abookinghostedpictetgoryuzawabookonlinewjerseyboomlajollamerican" +
"expressexyboschaefflerdalondrinamsskoganeindowapblogsiteleafamil" +
"ycompany-2bostik-serverrankoshigayachts3-website-us-west-2boston" +
"akijinsekikogentappsselfiparisor-fronishikatsuragit-reposts-and-" +
"telecommunicationsakyotanabellevuelosangelesjabbottjeldsundivtta" +
"svuotnakamurataiwanairforcechireadthedocscbgmbhartipschlesisches" +
"alangenishikawazukamisatohoboleslawieconomiastalowa-wolawabotani" +
"calgardeno-stagingminakamichiharabotanicgardenishimerabotanycath" +
"olicaxiaskimitsubatamibudejjuegoshikievennodesabaerobaticketsalo" +
"n-1bouncemerckmsdnipropetrovskjervoyageometre-experts-comptables" +
"altdalorenskogmodellingmxenishinomiyashironoddabounty-fullensake" +
"rrypropertiesaludiyboutiquebecommerce-shopitsitempurlotteboutire" +
"serve-onlinewmexicodyn-o-saurlandesalvadordalibabalena-devicesal" +
"zburgretakamatsukawabozen-sudtirolottokonamegatakatsukindustriab" +
"ozen-suedtirolouvrehabmerbplaceducatorprojectjmaxxxeroxfinitybra" +
"ndywinevalleybrasiliabresciabrindisibenikikugawashtenawdevcdnacc" +
"essobetsuitaijindustriesteamfamberkeleybristoloseyouriparliament" +
"jomelhusgardenishinoomotegohtawaramotoineppubtlsamegawabritishco" +
"lumbialowiezaganishinoshimatsunowruzhgorodeomniweatherchannelpus" +
"ercontentjxjampalacebroadcastlebtimnetzjavaldaostathelleluxembou" +
"rgrimstadrangedalublindesnesamnangerbroadwaybroke-itvedestrandra" +
"y-dnstracebrokerbronnoysundrayddns5ybrothermesaverdealerbrowsers" +
"afetymarketsampaleomurabrumunddalucaniabrunelastxn--0trq7p7nnish" +
"iokoppegardraydnsupdaterbrusselsamsclubartowellbeingzonebruxelle" +
"samsungripebryanskodjedugit-pagespeedmobilizeroticagliaricoharuh" +
"rbrynewportkmaxxn--11b4c3drivegarsheiheijinfinitinsureggioemilia" +
"romagnamsosnowiechernivtsiciliabuskerudrobaknoluoktachikawafflec" +
"elluciancrmadviseharag-cloud-charitychyattorneyagawakayamagazine" +
"kobayashikaoirmitakeharagusartsandnessjoenishitosashimizunaminam" +
"ibosognebuzentsujiiebuzzlgriwataraidrrbwesteuropenairbusantiques" +
"t-a-la-maisondre-landroidrudupontariobranconavstackareliancebzhi" +
"tomirbzzwestfalenishiwakintelligencecoloradoplateaudiopsysanokar" +
"umaifarsundyndns-homednsantabarbaracolumbusheycommunecommunity-p" +
"rochowicecomobaracomparemarkerryhotelsantacruzsantafedjeffersonc" +
"omsecaaskoyabearalvahkihokumakogenebakkeshibechambagriculturenne" +
"bugattiffanyaarborteaches-yogasawaracingrpartinternationalfirear" +
"msantamariakecondoshichinohealth-carereformemergencyahikobeardub" +
"aiduckdnsncfdyndns-ipartsantoandreamhostersanukintuitoyosatoyoka" +
"waconferenceconstructionconsuladoesntexisteingeekasaokamikitayam" +
"atsurinuyamashinatsukigatakasagotpantheonsiteconsultanthropology" +
"consultingruenoharacontactoyotapartycontagematsubaracontemporary" +
"arteducationalchikugodogadollsaobernardocontractorskenconventure" +
"shinodearthruherecifedexetercookingchannelsdvrdnsdojoburguidefen" +
"seljordyndns-mailcoolcooperativano-frankivskygearappasadenarashi" +
"nocopenhagencyclopedichofunatoriginstantcloudfrontdoorcoproducti" +
"onsaogoncarriercorporationcorsicahcesuoloansaotomeiwamashikokuch" +
"uocorvettenrissadonnagatorogersvp4cosenzakopanelblagrarchaeology" +
"eongbuk0cosidnsfor-better-thanawatchesapporocostumedicaltanisset" +
"taishinomakindlefrakkestadyndns-office-on-the-webercouchpotatofr" +
"iesardegnaroycoukashibatakasugainvestmentsardiniacouncilcouponsa" +
"rlcozoracqcxn--12cfi8ixb8lcranbrookuwanalyticsarpsborguitarsaruf" +
"utsunomiyawakasaikaitabashijonawatecrdyndns-picsasayamatta-varjj" +
"atoyotomiyazakinzais-a-candidatecreditcardyndns-remotewdyndns-se" +
"rverisigncreditunioncremonashgabadaddjaguarqhachinohedmarkashiha" +
"racrewhalingujoinvilleirvikashiwaracricketoyotsukaidocrimeast-ka" +
"zakhstanangercrotonecrownipassagensasebofagemologicallynxn--12co" +
"0c3b4evalled-aostamayufuettertdasnetzcrsaskatchewancruisesassari" +
"s-a-caterercuisinellancashirecipescaracalvinklein-berlindaskvoll" +
"pagesaudaculturalcentertainmentoyouracuneocupcakecuritibaghdadul" +
"toystre-slidrettozawacurvalledaostaobaomoriguchiharahkkeravjuedi" +
"schesapeakebayernuorochestercymruovatmallorcafederationcilla-spe" +
"ziacyonabarumemorialcyouthachiojiyaizuwakamatsubushikusakadogawa" +
"ferrarivneferrerotikagoshimalopolskanlandyndns-workshoparenakani" +
"ikawatanagurafetsundyndns1fgushikamifuranordreisa-hockeynutsirac" +
"usaintlouis-a-anarchistoireggio-emilia-romagnakatombetsumitakagi" +
"izefhvalerfidoomdnsiskinkyotobetsulikes-piedmonticellocalzonefie" +
"ldynnsauheradyndns-webhareidsbergentingulenfigueresinstagingwidd" +
"leitungsenfilateliafilegear-audnedalnfilegear-dealstahaugesunder" +
"seaportsinfolionetworkangerfilegear-gbizfilegear-iefilegear-jpmo" +
"rganfilegear-sg-1filminamiechizenfinalfinancefineartschulefinlan" +
"dynservebbsavannahgafinnoyfirebaseappatriafirenetrani-andria-bar" +
"letta-trani-andriafirenzefirestonefirewebhopocznordre-landynulme" +
"msettlersaveincloudyndns-wikirafirmdalegnicapebretonamicrolighti" +
"ngxn--1ctwolominamatargithubusercontentraniandriabarlettatranian" +
"driafishingokasellfylkesbiblackbaudcdn-edgestackhero-networkingg" +
"roupowiathletajimageandsoundandvision-riopretochigiessensiositel" +
"evision-webpaashorokanaiefitjarvodkagaminogatagajobojis-a-chefas" +
"tly-terrariumetacentrumeteorappassenger-associationfitnessettlem" +
"entranoyfjalerflekkefjordynv6flesbergflickragerokunohealthcareer" +
"schulserverflirfloginlinefloraflorencefloridatsunanjoetsuwanouch" +
"ikujogaszkolancasterfloripaderbornfloristanohatajimidsundynvpnpl" +
"us-4floromskogflowerschwarzgwangjuifminamifuranowtvallee-aostero" +
"yfltranslateflynnhosting-clusterfndyroyrvikingunmaniwakuratefnwk" +
"asukabedzin-addrammenuniversityfoodnetworkdalfor-ourfor-somedio-" +
"campidano-mediocampidanomediofor-theaterforexrothachirogatakamor" +
"iokakudamatsueforgotdnschweizforli-cesena-forlicesenaforlikescan" +
"dyn53forsalegoldpoint2thisamitsukeforsandasuoloftransportefortal" +
"fortextileikangerfortmissoulanciafortworthadanore-og-uvdalfosnes" +
"ciencecentersciencehistoryfotransurlfoxafozfranamizuhobby-sitefr" +
"ancaiserniafranziskanerimaringatlantajiris-a-conservativegascien" +
"tistordalfredrikstadtvscjohnsonfreeddnsfreebox-oscrapper-sitefre" +
"edesktoppdalfreemasonryfreemyiphosteurovisionfreesitefreetlscrap" +
"pingfreiburgfreseniusculturecreationfribourgfriuli-v-giuliafriul" +
"i-ve-giuliafriuli-vegiuliafriuli-venezia-giuliafriuli-veneziagiu" +
"liafriuli-vgiuliafriuliv-giuliafriulive-giuliafriulivegiuliafriu" +
"livenezia-giuliafriuliveneziagiuliafriulivgiuliafrlfroganscrysec" +
"uritytacticservehumourfrognfrolandfrom-akrehamnfrom-alfrom-arfro" +
"m-azimuthatogayabukijobservableusercontentrapaniizafrom-capetown" +
"news-stagingfrom-coffeedbackplaneappaviancargodaddyn-vpndnservei" +
"rchonanbulsan-suedtirolucernefrom-ctravelchannelfrom-dchoseikaru" +
"gamvikarlsoyfrom-deatnunjargafrom-flanderserveminecraftravelersi" +
"nsurancefrom-gaulardalfrom-hichisodegaurafrom-iafrom-idfrom-ilfr" +
"om-in-brbar1from-kservemp3from-kyowariasahikawafrom-langevagrige" +
"ntomologyeonggiehtavuoatnabudapest-a-la-masion-rancherkasydneyfr" +
"om-malselvendrelluciancrmadvancefrom-mdfrom-medizinhistorischese" +
"rvep2pfizerfrom-mifunefrom-mnfrom-modalenfrom-mservepicservequak" +
"efrom-mtnfrom-nctulanservesarcasmatartanddesignfrom-ndfrom-nefro" +
"m-nhktrdfrom-njservicesevastopolefrom-nminamiiseoullensvanguardf" +
"rom-nvallee-d-aosteigenfrom-nynysagaeroclubmedecincinnativeameri" +
"canantiquest-mon-blogueurodirumaceratabuseating-organichoshibuya" +
"habackyardsandvikcoromantovalle-daostavangerfrom-ohdattorelayfro" +
"m-oketogolffansevenassisicilyfrom-orfrom-padoval-daostavalleyfro" +
"m-pratogurafrom-ris-a-cpadualstackasumigaurayasudafrom-schoenbru" +
"nnfrom-sdscloudfrom-tnfrom-txn--1lqs03nfrom-utazurestaticappspac" +
"eusercontentrendhostingfrom-vald-aostarostwodzislawhoswholdingsm" +
"all-webredirectmeeresistancefrom-vtrentin-sud-tirolfrom-wafrom-w" +
"iardwebspacefrom-wvalleeaosteinkjerusalembroideryfrom-wyfrosinon" +
"efrostaplesewienfroyaitakahamalvikasuyanaizuerichardlillesandefj" +
"ordfruskydivingfstcgroupgfoggiafujiiderafujikawaguchikonefujimin" +
"okamoenairguardiannakadomarinebraskaunicommbankaszubyfujinomiyad" +
"attowebcampinashikiminohostfoldnavyfujiokayamamurogawafujisatosh" +
"onairlinedre-eikerfujisawafujishiroishidakabiratoridebianfujitsu" +
"rugashimandalfujiyoshidavvenjargap-northeast-3fukayabeatsharis-a" +
"-cubicle-slavellinodeobjectsharpharmacienshawaiijimarburgfukuchi" +
"yamadavvesiidappnodebalancertificationfukudomigawafukuis-a-democ" +
"ratrentin-sudtirolfukumitsubishigakirovogradoyfukuokazakiryuohku" +
"rafukuroishikarikaturindalfukusakisarazure-mobileirfjordfukuyama" +
"gatakaharussiafunabashiriuchinadazaifudaigojomedicinaharimalbork" +
"atowicefunagatakahashimamakishiwadafunahashikamiamakusatsumasend" +
"aisennangonohejis-a-designerfundaciofunkfeuerfuoiskujukuriyamang" +
"ooglecodespotrentin-sued-tirolfuosskoczowiiheyakumodernfurniture" +
"ggio-calabriafurubirafurudonostiaafurukawairportland-4-salernodu" +
"minamiizukaminokawanishiaizubangefusoftwarezzoologyfussagamihara" +
"futabayamaguchinomihachimanagementrentin-suedtirolfutboldlygoing" +
"nowhere-for-morenakasatsunairtelebitbridgestoneen-rootaruis-a-do" +
"ctorfuttsurugimperiafuturecmshellaspeziafuturehostingfuturemaili" +
"ngfvghangglidinghangoutsystemscloudsitehannanmokuizumodenakayama" +
"nnorth-kazakhstanhannorthflankautokeinotairestaurantrentino-a-ad" +
"igehanyuzenhapmircloudletshimojis-a-hard-workershimokawahappounz" +
"enharstadharvestcelebrationhasamansionshimokitayamattelekommunik" +
"ationhasaminami-alpshimonitayanagitappharmacyshimonosekikawahash" +
"banghasudahasura-apphdfcbankazohasvikazteleportlligatrentino-aad" +
"igehatoyamazakitahiroshimanxn--1lqs71dhatsukaichikaiseiyoichippu" +
"betsubetsugarusrcfastlylbanzaicloudappspotagerhattfjelldalhayash" +
"imamotobungotakadagestangeorgeorgiahazuminobusells-for-lesshimos" +
"uwalkis-a-hunterhelsinkitakamiizumisanofidelitysvardontexistmein" +
"-iservebeero-stagehembygdsforbundhemneshimotsukehemsedalhepforge" +
"blockshimotsumayfirstockholmestrandherokusslattuminamimakis-a-kn" +
"ightpointtohnoshoooshikamaishimodateheroyhgtvalleedaostehidorahi" +
"gashiagatsumagoianiahigashichichibunkyonanaoshimakanegasakilatir" +
"onthewifiatlassian-dev-myqnapcloudcontrolledogawarabikomaezakiru" +
"nogiftshinichinanhigashihiroshimanehigashiizumozakitakatakanezaw" +
"ahigashikagawahigashikagurasoedahigashikawakitaaikitakyushuaiahi" +
"gashikurumeetrentino-alto-adigehigashimatsushimaoris-a-landscape" +
"rugiahigashimatsuyamakitaakitadaitoigawahigashimurayamamotorcycl" +
"eshinjournalismailillehammerfeste-iphiladelphiaareadmyblogsytehi" +
"gashinarusells-for-ustkanmakitchenhigashinehigashiomitamamurausu" +
"kitamihamadahigashiosakasayamanakakogawahigashishirakawamatakaok" +
"almykiahigashisumiyoshikawaminamiaikitamotosumy-gatewayhigashits" +
"unorthwesternmutualhigashiurawa-mazowszexnetrentino-altoadigehig" +
"ashiyamatokoriyamanashifteditorxn--1qqw23ahigashiyodogawahigashi" +
"yoshinogaris-a-lawyerhiraizumisatohmapartmentshinjukumamotoyamas" +
"hikehirakatashinagawahiranairtrafficplexus-1hirarahiratsukaerutw" +
"entehirayakagehistorichouseshinkamigototalhitachiomiyagildeskali" +
"szhitachiotagophilatelyhitraeumtgeradegreehjartdalhjelmelandhole" +
"ckochikushinonsenergyholidayhomegoodshinshinotsurgeonshalloffame" +
"lbournehomeiphilipsynology-diskstationhomelinkyard-cloudjiffyres" +
"dalhomelinuxn--2m4a15ehomeofficehomesecuritymacaparecidahomesecu" +
"ritypchoyodobashichikashukujitawaravpagexlukowestus2homesenseeri" +
"nghomesklepphoenixn--2scrj9christiansburgrondarhomeunixn--30rr7y" +
"hondahongotembaixadahonjyoitakarazukaluganskazunoticeablevangerh" +
"ornindalhorsells-itrentino-s-tirolhortendofinternet-dnshinshiroh" +
"ospitalhoteleshintokushimahotelwithflightshintomikasaharahotmail" +
"hoyangerhoylandetroitskddiamondshinyoshitomiokamishihoronobeauxa" +
"rtsandcraftshiojirishirifujiedahumanitieshioyandexcloudhurdalhur" +
"umajis-a-liberalhyllestadhyogoris-a-libertarianhyugawarahyundaiw" +
"afuneis-uberleetrentino-sudtirolis-very-badajozis-a-painteractiv" +
"estfoldis-very-evillageis-very-goodyearis-very-niceis-very-sweet" +
"pepperis-with-thebandownloadisleofmanaustdaljenv-arubajddarchite" +
"cturealtorlandjeonnamerikawauejetztrentino-sued-tiroljevnakershu" +
"sdecorativeartshopwarendalenugjewelryjewishartgalleryjfkharkovao" +
"jgorajlljls-sto1jls-sto2jls-sto3jmphxn--32vp30hadselburgjnjaworz" +
"nosegawajoyentrentino-suedtiroljoyokaichibalashovhaebaruericsson" +
"gdalenviknakatsugawajpnjprshoujis-a-personaltrainerjurkoshimizum" +
"akiyosatokaizukamikoaniihamatamakawajimaritimoldell-ogliastrader" +
"koshunantankhmelnitskiyamarugame-hostyhostingkosugekotohiradomai" +
"nstitutekotourakouhokutamakiyosemitekounosupabasembokukiyosunnda" +
"lkouyamarylhurstjordalshalsenkouzushimasfjordenkozagawakozakizun" +
"okunimilitarykozowildlifestylekpnkppspdnshowtimeldalkrasnikahoku" +
"tokamachintaifun-dnsaliashwilliamhillkrasnodarkredstonekrelliank" +
"ristiansandcatsienarutolgakristiansundkrodsheradkrokstadelvalle-" +
"aostatic-accessigdalkryminamioguni5kumanotogawakumatorinotteroyk" +
"umejimashikis-a-republicancerresearchaeologicaliforniakumenantok" +
"igawakunisakis-a-rockstarachowicekunitachiarailwaykunitomigusuku" +
"leuvenetokashikis-a-socialistdlibestadkunneppuboliviajessheimper" +
"trixcdn77-secureggiocalabriakunstsammlungkunstunddesignkuokgroup" +
"ilotsilkhmelnytskyivaporcloudkuregruhostingkurgankurobeepilepsyk" +
"kylvenicekurogimimatakatoris-a-soxfankuroisogndalkuromatsunais-a" +
"-studentalkurotakikawasakis-a-teacherkassyno-dshiraois-a-linux-u" +
"sershirahamatonbetsurgerykushirogawakustanais-a-techietis-a-llam" +
"archeapigeelvinckfh-muensterkusuppliesimple-urlkutchanelverumina" +
"misanrikubetsupplykutnovecoregontrailroadkuzumakis-a-therapistoi" +
"akvafjordkvalsundkvamlidlugolekafjordvagsoygardendoftheinterneth" +
"nologykvanangenkvinesdalkvinnheradkviteseidatingkvitsoykwpspectr" +
"uminamitanekzmisakis-an-accountantshiraokamitondabayashiogamagor" +
"iziamisasaguris-an-actormisawamisconfusedmishimassivegridmissile" +
"wismillermisugitokorozawamitourismilezajskhplaystation-cloudyclu" +
"stermitoyoakemiuramiyazurecontainerdpolicemiyotamanomjondalenmlb" +
"fanmontrealestatefarmequipmentrentinoa-adigemonza-brianzapposird" +
"almonza-e-della-brianzaptokuyamasudamonzabrianzaramonzaebrianzam" +
"onzaedellabrianzamoonscaleforcemordoviamoriyamatsumaebashikshack" +
"netrentinoaadigemoriyoshiminamiashigaramormonstermoroyamatsumoto" +
"fukemortgagemoscowinbarclaycards3-external-1moseushistorymosjoen" +
"moskeneslupsklabudhabikinokawabarthagakhanamigawamosslzmosvikmps" +
"pbar2moteginowaniigatakahatakaishimogosenmoviemovimientokyotango" +
"uvichungnamdalseidfjordynathomebuiltwithdarkarmoymozilla-iotrent" +
"inoalto-adigemtranbymuginozawaonsenmuikaminoyamaxunispacemukoebe" +
"nhavnmulhouservegame-servermunakatanemuncienciamuosattemupimient" +
"aketomisatomobelementoraymurmansknx-serversicherungmurotorcraftr" +
"entinoaltoadigemusashinoharamuseetrentinos-tirolmuseumvereniging" +
"musicarbonia-iglesias-carboniaiglesiascarboniamutsuzawamy-vigorg" +
"emy-wanggoupilemyactivedirectorymyasustor-elvdalmycdmycloudnsmol" +
"arvikomaganemydattolocalhistorymyddnsgeekgalaxymydissentrentinos" +
"tirolmydobisshikis-an-actresshiratakahagithubpreviewsaikisofukus" +
"himangyshlakasamatsudopaashishikuis-a-musicianmydroboehringerike" +
"mydsmushcdn77-sslingmyeffectrentinosud-tirolmyfastblogermyfirewa" +
"llonieruchomoscienceandindustrynmyforuminamiuonumasoymyfritzmyft" +
"paccessnoasakakinokiamyhome-servermyjinomykolaivarggatrentinosud" +
"tirolmymailermymediapchurchaseljeepsondriodejaneirodoymyokohamam" +
"atsudamypepinbarclays3-fips-us-gov-west-1mypetsokndalmyphotoshib" +
"alatinombrendlyngeniwaizumiotsukumiyamazonawsglobalacceleratorah" +
"imeshimabaridagawakuyachimataikikonaikawachinaganoharamcoachampi" +
"onshiphoptobamadridnbloggerimo-siemenscaledekaasdaburmypictureso" +
"larssonmypsxn--3ds443gmysecuritycamerakermyshopblocksolognemysho" +
"pifymyspreadshoppingmythic-beastsolundbeckomakiyokawaramytis-a-b" +
"ookkeeperspectakasakitashiobaramytuleap-partnersomamyvncircustom" +
"er-ocimdbananarepublic66mywireitrentinosued-tirolplatterpioneerp" +
"lazaplcube-serverplumbingoplurinacionalpodhalepodlasiellaktyubin" +
"skiptveterinairealmpmnpodzonepohlpoivronpokerpokrovskommunalforb" +
"undpoliticarrdpolitiendapolkowicepoltavalle-d-aostaticsopotrenti" +
"nosuedtirolpomorzeszowindmillponpesaro-urbino-pesarourbinopesaro" +
"masvuotnaritakoelnponypordenonepornporsangerporsangugeporsgrunna" +
"nyokoshibahikariwanumatakinouepoznanpraxis-a-bruinsfanprdpresidi" +
"oprgmrprimetelemarkommuneprincipeprivatizehealthinsuranceprofesi" +
"onalprogressivestnesor-odalpromombetsupportrentinsud-tirolproper" +
"typrotectionprotonetrentinsudtirolprudentialpruszkowindowskrakow" +
"innersor-varangerprvcyberlevagangaviikanonjis-an-artistgstageprz" +
"eworskogpugliapulawypupippueblockbusterniiminamiawajikis-an-anar" +
"chistoricalsocietypvhagebostadpvtrentinsued-tirolpwcistrondheimm" +
"obilienissayokkaichiropractichernovtsyncloudurbanamexhibitioniss" +
"andiegomutashinainterhostsolutionsandoypythonanywherepaircraftin" +
"gvollolipopittsburghofficialpzqldqotoyohashimotoolsorfoldqponiat" +
"owadaqslgbtrentinsuedtirolqualifioappiwatequickconnectrentoyonak" +
"agyokutoyakolobrzegersundquicksytesorocabalestrandabergamoarekey" +
"machineustargardquipelementsorreisahayakawakamiichikawamisatotto" +
"ris-an-engineeringqvcitadeliverydyndns-at-homedepotenzamamidorit" +
"togitsumidatlantichirurgiens-dentistes-en-franceswidnikkokonoesw" +
"iebodzin-dsldswiftcoverswinoujscienceandhistoryswissmarterthanyo" +
"usynology-dsouthwest1-uslivinghistorytushuissier-justicetuvallea" +
"ostaverntuxfamilytwmailvevelstadvibo-valentiavibovalentiavideovi" +
"llasphinxn--3e0b707evinnicasacamdvrcampinagrandebuilderschmidtre" +
"-gauldalvinnytsiavipsinaappixolinovirginiavirtual-userveexchange" +
"virtualcloudvirtualservervirtualuserveftpizzavirtueeldomein-vigo" +
"rlicevirtuelvisakegawaviterboknowsitallvivolkenkundenvixn--3hcrj" +
"9civilisationisshingucciprianidyndns-at-workisboringrongausdalut" +
"skarpaczeladzvlaanderenvladikavkazimierz-dolnyvladimirvlogintoyo" +
"nezawavminanovologdanskongsvingervolvolkswagentspjelkavikomorots" +
"ukagawavolyngdalvoorlopervossevangenvotevotingvotoyonovps-hostro" +
"wiecivilizationiyodogawawithyoutuberspacekitagatargetmyipkomforb" +
"arcelonagawalbrzycharternopilawalesundgcanonoichinomiyakehimejib" +
"igawaustraliamuneues3-ap-south-1wiwatsukiyonortonwixsitewloclawe" +
"konskowolayangroupiemontewmcloudwmflabsrhtrevisojamisonwnextdire" +
"ctromsakatakkofuefukihabororosowawoodsideloittevaksdalworse-than" +
"dawowiospydebergwpdevcloudwpenginepoweredwphostedmailwpmucdnplan" +
"tsomnarviikamiokameokamakurazakitaurawpmudeveloperauniterois-cer" +
"tifiedunetlifyis-a-nascarfanwritesthisblogwroclawitdkoninjambylw" +
"tcirclerkstagets-itromsokamogawawtfastvps-serveronakanotoddenwuo" +
"zuwzmiuwajimaxn--45brj9civilwarmiasakuchinotsuchiurakawatchandcl" +
"ockaruizawaxn--45q11clanbibaidarmeniaxn--4gbriminingxn--4it168dx" +
"n--4it797konyvelohmusashimurayamarylandxn--4pvxs4allxn--54b7fta0" +
"ccldmailuxuryxn--55qw42gxn--55qx5dxn--5js045dxn--5rtp49cleverapp" +
"stmnxn--5rtq34kooris-a-photographerokuapphotographysioxn--5su34j" +
"936bgsgxn--5tzm5gxn--6btw5axn--6frz82gxn--6orx2rxn--6qq986b3xlxn" +
"--7t0a264clic20001wwwfarmsteadyndns-blogdnsanfranciscofreakunemu" +
"rorangecloudplatform0xn--80aaa0cvacationsrlxn--80adxhksrvaroyxn-" +
"-80ao21axn--80aqecdr1axn--80asehdbarefootballooningjovikaraganda" +
"ustrheimatunduhrennesoyokosukanramusementdllclstagehirnrtatarant" +
"ours3-ap-southeast-1xn--80aswgxn--80augustowithgoogleapiszxn--8l" +
"tr62kopervikhersonxn--8pvr4uxn--8y0a063axn--90a1aflakstadaokagak" +
"icks-assnasaarlandxn--90a3academiamicable-modemoneyxn--90aeropor" +
"talaheadjudaicadaquestorebaselectritonxn--90aishobarakawagoexn--" +
"90amcdirxn--90azhytomyravendbargainstancempresashibetsukuibmdisc" +
"ourses3-sa-east-1xn--9dbhblg6dietrusteexn--9dbq2axn--9et52uxn--9" +
"krt00axn--andy-iraxn--aroport-byaotsurnadalxn--asky-iraxn--aursk" +
"og-hland-jnbarreauctionfabricafjs3-us-east-2xn--avery-yuasakuhok" +
"ksundxn--b-5gaxn--b4w605ferdxn--balsan-sdtirol-nsbstorfjordxn--b" +
"ck1b9a5dre4clicketcloudcontrolappgafanxn--bdddj-mrabdxn--bearalv" +
"hki-y4axn--berlevg-jxaxn--bhcavuotna-s4axn--bhccavuotna-k7axn--b" +
"idr-5nachikatsuuraxn--bievt-0qa2xn--bjarky-fyasakaiminatoyookana" +
"zawaxn--bjddar-ptarnobrzegyptianxn--blt-elabourxn--bmlo-grainger" +
"xn--bod-2natalxn--bozen-sdtirol-2obanazawaxn--brnny-wuacademy-fi" +
"rewall-gatewayxn--brnnysund-m8accident-investigation-aptibleadpa" +
"gesquare7xn--brum-voagatrvestre-slidreportrogstadxn--btsfjord-9z" +
"axn--bulsan-sdtirol-nsbarrel-of-knowledgeappleborkarasjohkameyam" +
"atotakadauthgear-stagingjesdalimanowarudaukraanghkembuchikumagay" +
"agawakepnoipirangalsaceobiragrocerybnikeisenbahnatuurwetenschapp" +
"engineastcoastaldefenceastus2xn--c1avgxn--c2br7gxn--c3s14mincomc" +
"astresindevicenzaporizhzhiaxn--cck2b3barrell-of-knowledgecompute" +
"rhistoryofscience-fictionredumbrellaakesvuemieleccemrxn--cckwcxe" +
"tdxn--cesena-forl-mcbremangerxn--cesenaforl-i8axn--cg4bkis-found" +
"ationxn--ciqpnxn--clchc0ea0b2g2a9gcdxn--comunicaes-v6a2oxn--corr" +
"eios-e-telecomunicaes-ghc29axn--czr694barsycenterprisesakikuchik" +
"useihicampobassociatest-iservecounterstrikeu-1xn--czrs0try-snowp" +
"lowiczest-le-patronxn--czru2dxn--czrw28barsyonlinewhampshirealty" +
"dalpha-myqnapcloud66xn--d1acj3basicservercelliguriauthgearappspa" +
"cehosted-by-previderhclouddnslivefsnillfjorddnss3-ca-central-1xn" +
"--d1alfaromeoxn--d1atrycloudflareplantationxn--d5qv7z876clickris" +
"inglesangoxn--davvenjrga-y4axn--djrs72d6uyxn--djty4koryokamikawa" +
"nehonbetsurutaharaxn--dnna-grajewolterskluwerxn--drbak-wuaxn--dy" +
"ry-iraxn--e1a4clinichitachinakagawassamukawatarikuzentakatairave" +
"nnagasakimobetsuldaluccaravantaarparmatsuuraxn--eckvdtc9dxn--efv" +
"n9storjcloud-ver-jpchristmasakinderoyxn--efvy88haibarakitahataka" +
"nabeautysfjordxn--ehqz56nxn--elqq16hair-surveillancexn--eveni-0q" +
"a01gaxn--f6qx53axn--fct429kosaigawaxn--fhbeiarnxn--finny-yuaxn--" +
"fiq228c5hstpetersburgxn--fiq64basilicataniauthordalandds3-eu-cen" +
"tral-1xn--fiqs8streamscompute-1xn--fiqz9studioxn--fjord-lraxn--f" +
"jq720axn--fl-ziaxn--flor-jraxn--flw351exn--forl-cesena-fcbsstudy" +
"namisches-dnsortlandxn--forlcesena-c8axn--fpcrj9c3dxn--frde-gran" +
"drapidstuff-4-salexn--frna-woaraisaijosoyrovigotsukisosakitagawa" +
"xn--frya-hraxn--fzc2c9e2cliniquedapliernewyorkshirebungoonordest" +
"e-idchitosetoeigersundurhamburgroks-thisayamanobeokakegawaxn--fz" +
"ys8d69uvgmailxn--g2xx48clintonoshoesanjotelulubindaluzernxn--gck" +
"r3f0fauskedsmokorsetagayaseralingenoamishirasatogliattis-a-celti" +
"csfanxn--gecrj9clothingdustdatadetectksatxn--12c1fe0bradescotlan" +
"dyndns-freeboxosascoli-picenordkapparochernigovernmentlon-2xn--g" +
"gaviika-8ya47hakatanorfolkebibleksvikatsushikabeebyteapplinzis-a" +
"-financialadvisor-aurdalxn--gildeskl-g0axn--givuotna-8yasugitlab" +
"orxn--gjvik-wuaxn--gk3at1exn--gls-elacaixaxn--gmq050is-gonexn--g" +
"mqw5axn--gnstigbestellen-zvbrplsbxn--3oq18vl8pn36axn--gnstiglief" +
"ern-wobihirosakikamijimatsusakahoginankokubunjis-into-animegurow" +
"nproviderxn--h-2failxn--h1aeghakodatexn--h1ahnxn--h1alizxn--h2br" +
"eg3evenestufftoread-booksnesoruminamiyamashirokawanabelaudibleas" +
"ingxn--h2brj9c8cn-northwest-1xn--h3cuzk1discountysnestuttgartroa" +
"ndinosaurepbodynamic-dnsoundcastronomy-routerxn--hbmer-xqaxn--hc" +
"esuolo-7ya35basketballfinanzgorzeleccogladedyn-berlincolnavigati" +
"onavoizumizakiitatebayashiibahccavuotnagaraholtalenglandiscovery" +
"ggeeu-2xn--hery-iraxn--hgebostad-g3axn--hkkinen-5waxn--hmmrfeast" +
"a-s4accident-prevention-k3surreyxn--hnefoss-q1axn--hobl-iraxn--h" +
"oltlen-hxaxn--hpmir-xqaxn--hxt814exn--hyanger-q1axn--hylandet-54" +
"axn--i1b6b1a6a2exn--imr513nxn--indery-fyasuokannamiharuxn--io0a7" +
"is-into-carshisohugheshisuifuelluciancrmrecruitrentino-stirolxn-" +
"-j1adplatformshangrilaquilanxessooxn--j1aefbsbxn--1ck2e1bar0emma" +
"fann-arboretumbriamallamaceiobbcg12038xn--j1ael8batochiokinoshim" +
"aizurugbyglandroverhallahppiacenzachpomorskienavuotnapleskns3-us" +
"-gov-west-1xn--j1amhakonexn--j6w193gxn--jlq480n2rgxn--jlq61u9w7b" +
"atsfjordishakotanayorovnobserverxn--jlster-byatominamidaitomanch" +
"esterxn--jrpeland-54axn--jvr189miniserverxn--k7yn95exn--karmy-yu" +
"axn--kbrq7oxn--kcrx77d1x4axn--kfjord-iuaxn--klbu-woaxn--klt787dx" +
"n--kltp7dxn--kltx9axn--klty5xn--3pxu8konsulatrobeeldengeluidvare" +
"servdxn--koluokta-7ya57hakubahcavuotnagaivuotnagaokakyotambabydg" +
"oszczecinemagnetnedalipaywhirlxn--kprw13dxn--kpry57dxn--kput3is-" +
"into-cartoonshitaramaxn--krager-gyatsukanoyaltakashimarnardalxn-" +
"-kranghke-b0axn--krdsherad-m8axn--krehamn-dxaxn--krjohka-hwab49j" +
"devcloudfunctionshizukuishimofusaitoshimatsuzakis-a-patsfanxn--k" +
"snes-uuaxn--kvfjord-nxaxn--kvitsy-fyatsushiroxn--kvnangen-k0axn-" +
"-l-1fairwindsusakis-an-entertainerxn--l1accentureklamborghinikol" +
"aeventsusonoxn--laheadju-7yawaraxn--langevg-jxaxn--lcvr32dxn--ld" +
"ingen-q1axn--leagaviika-52bauhauspostman-echocolatemasekd1xn--le" +
"sund-huaxn--lgbbat1ad8jdfaststacksaves-the-whalessandria-trani-b" +
"arletta-andriatranibarlettaandriaxn--lgrd-poacctrysiljanxn--lhpp" +
"i-xqaxn--linds-pramericanartunespeedpartnerxn--lns-qlavagiskexn-" +
"-loabt-0qaxn--lrdal-sraxn--lrenskog-54axn--lt-liacngrossetouchih" +
"ayaakasakawaharaxn--lten-granexn--lury-iraxn--m3ch0j3axn--mely-i" +
"raxn--merker-kuaxn--mgb2ddesuzakanagawaxn--mgb9awbfbx-oslocuscou" +
"ntryestateofdelawareclaimsavonarusawaxn--mgba3a3ejtunkongsbergxn" +
"--mgba3a4f16axn--mgba3a4fra1-deltaitogakushimotoganexn--mgba7c0b" +
"bn0axn--mgbaakc7dvfbxostrowwlkpmguovdageaidnulvikashiwazakiwielu" +
"nnerxn--mgbaam7a8hakuis-a-geekatsuyamarshallstatebankaufentigerx" +
"n--mgbab2bdxn--mgbah1a3hjkrdxn--mgbai9a5eva00bellunord-aurdalvda" +
"laskanittedallasalleangaviikadenagahamaroyerxn--mgbai9azgqp6jeju" +
"niperxn--mgbayh7gpalermomahachijolsterxn--mgbbh1a71exn--mgbc0a9a" +
"zcgxn--mgbca7dzdoxn--mgbcpq6gpa1axn--mgberp4a5d4a87gxn--mgberp4a" +
"5d4arxn--mgbgu82axn--mgbi4ecexposedxn--mgbpl2fhskypexn--mgbqly7c" +
"0a67fbcnpyatigorskolecznagasukexn--mgbqly7cvafr-1xn--mgbt3dhdxn-" +
"-mgbtf8flapymnturystykaneyamazoexn--mgbtx2beneventodayombolzano-" +
"altoadigeologyomitanoceanographiqueu-3xn--mgbx4cd0abbvieeexn--mi" +
"x082fedorainfraclouderaxn--mix891fedorapeoplegallodingenxn--mjnd" +
"alen-64axn--mk0axin-the-bandais-into-gamessinazawaxn--mk1bu44cns" +
"annanxn--mkru45is-leetrentino-sud-tirolxn--mlatvuopmi-s4axn--mli" +
"-tlavangenxn--mlselv-iuaxn--moreke-juaxn--mori-qsakuragawaxn--mo" +
"sjen-eyawatahamaxn--mot-tlazioxn--mre-og-romsdal-qqbuseranishiar" +
"itakurashikis-lostre-toteneis-a-nursellsyourhomeftphonefosshirak" +
"okamiminershiranukamisunagawaxn--msy-ula0hakusanagochijiwadefini" +
"mamateramochizukinkobierzycexn--mtta-vrjjat-k7afedoraprojectozsd" +
"elmenhorstalbansaxoxn--muost-0qaxn--mxtq1minisitexn--ngbc5azdxn-" +
"-ngbe9e0axn--ngbrxn--41axn--nit225kosakaerodromegallupaascolipic" +
"eno-ipifony-1xn--nmesjevuemie-tcbalsan-sudtirollagdenesnaaseinet" +
"-freaksuzukananiikappudoxn--nnx388axn--nodessakurais-not-certifi" +
"edxn--nqv7fs00emaxn--nry-yla5gxn--ntso0iqx3axn--ntsq17gxn--ntter" +
"y-byaeservehalflifeinsurancexn--nvuotna-hwaxn--nyqy26axn--o1ache" +
"rnihivgubsuzukis-bytomaritimekeepingxn--o3cw4haldenxn--o3cyx2axn" +
"--od0algxn--od0aq3bentleyonagoyautomotivelandeportexasnesoddenma" +
"rkhangelskjakdnepropetrovskiervaapsteiermarkanzakiwakunigamihokk" +
"aidovre-eikerxn--ogbpf8flatangerxn--oppegrd-ixaxn--ostery-fyaxn-" +
"-osyro-wuaxn--otu796dxn--p1acfeiraquarelleaseeklogeschokokekscho" +
"koladenxn--p1ais-savedxn--pgbs0dhlx3xn--porsgu-sta26fermockasser" +
"versaillescholarshipschoolsztynsettsurfashionxn--pssu33lxn--pssy" +
"2uxn--q7ce6axn--q9jyb4cntmparsannohelplfinancialvivanovoldaxn--q" +
"cka1pmckinseyxn--qqqt11minnesotaketakayamassa-carrara-massacarra" +
"ramassabusinessebykleclerchromediatechnologyxn--qxa6axn--qxamste" +
"rdamnserverbaniaxn--rady-iraxn--rdal-poaxn--rde-ulaxn--rdy-0naba" +
"ris-slickhakassiaxn--rennesy-v1axn--rhkkervju-01aferraraxn--rhol" +
"t-mragowoltlab-democraciaxn--rhqv96gxn--rht27zxn--rht3dxn--rht61" +
"exn--risa-5naturalhistorymuseumcenterxn--risr-iraxn--rland-uuaxn" +
"--rlingen-mxaxn--rmskog-byaxn--rny31halsaitamatsukuris-a-greenxn" +
"--rovu88beppublishproxyonagunicloudiskussionsbereichattanooganor" +
"ddalimitedisrechtranakaiwamizawawsmpplanetariumcpreservationfsho" +
"strodawarautoscanadaeguambulancentralus-2xn--rros-granvindafjord" +
"xn--rskog-uuaxn--rst-0naturalsciencesnaturellesvalbardunloppacif" +
"icitichiryukyuragifuchungbukharaumalatvuopmicrosoftbankariyamein" +
"forumzxn--rsta-framercanvasvcivilaviationissedaluroyxn--rvc1e0am" +
"3exn--ryken-vuaxn--ryrvik-byaxn--s-1faithammarfeastafricapitalon" +
"ewspaperxn--s9brj9collectionxn--sandnessjen-ogbeskidyn-ip24lima-" +
"cityeatselinogradimo-i-rana4u2-localhostrolekaniepce12hpalmasera" +
"ti234xn--sandy-yuaxn--sdtirol-n2axn--seral-lraxn--ses554gxn--sgn" +
"e-graphoxn--42c2d9axn--skierv-utazasveioxn--skjervy-v1axn--skjk-" +
"soaxn--sknit-yqaxn--sknland-fxaxn--slat-5naturbruksgymnxn--slt-e" +
"labcieszynh-serveblogspotaribeiraogakibichuoxn--smla-hraxn--smna" +
"-gratangentlentapisa-geekoseis-a-playershiftcryptonomichigangwon" +
"xn--snase-nraxn--sndre-land-0cbestbuyshouses3-us-west-1xn--snes-" +
"poaxn--snsa-roaxn--sr-aurdal-l8axn--sr-fron-q1axn--sr-odal-q1axn" +
"--sr-varanger-ggbetainaboxfusejnyanagawalmartattoolforgerockartu" +
"zyoriikarasjokarasuyamarriottaxihuanhlfanhs3-us-west-2xn--srfold" +
"-byaxn--srreisa-q1axn--srum-gratis-a-bulls-fanxn--stfold-9xaxn--" +
"stjrdal-s1axn--stjrdalshalsen-sqbhzcasadelamonedanceu-4xn--stre-" +
"toten-zcbieidskoguchikuzenikonanporocelotenkawaveroykenflfanpach" +
"igasakids3-eu-west-1xn--t60b56axn--tckwebthingsvelvikomvuxn--3bs" +
"t00minamiminowaxn--tiq49xqyjelasticbeanstalkharkivanylvenneslask" +
"errylogisticshizuokamitsuexn--tjme-hraxn--tn0agrinetbankosherbro" +
"okegawaxn--tnsberg-q1axn--tor131oxn--trany-yuaxn--trentin-sd-tir" +
"ol-rzbielawaltervistainaioirasebastopologyeongnamegawafaicloudin" +
"eat-urlimoliseminevje-og-hornnes3-website-ap-northeast-1xn--tren" +
"tin-sdtirol-7vbiellair-traffic-controlleyoshiokanumazuryukiiyama" +
"nouchikuhokuryugasakitanakagusukumodumeloyalistoragextraspace-to" +
"-rentalstomakomaibaravocatanzarowbq-aurskog-holandingivingjemnes" +
"3-ap-southeast-2xn--trentino-sd-tirol-c3bieszczadygeyachiyodaeje" +
"onbukcoalwaysdatabaseballangenkainanaejrietisalatinabenonicbcn-n" +
"orth-1xn--trentino-sdtirol-szbievat-band-campaniavoues3-eu-west-" +
"2xn--trentinosd-tirol-rzbifukagawashingtondclk3xn--trentinosdtir" +
"ol-7vbigv-infolldalivornow-dns3-website-ap-southeast-1xn--trenti" +
"nsd-tirol-6vbihorologyukuhashimoichinosekigaharaxarnetflixilovec" +
"ollegefantasyleaguernseyokotebetsuikirkenes3-eu-west-3utilities-" +
"1xn--trentinsdtirol-nsbikedaemonmoutheworkpccweddinglassassinati" +
"onalheritagexn--trgstad-r1axn--trna-woaxn--troms-zuaxn--tysvr-vr" +
"axn--uc0atvestre-totennishiawakuraxn--uc0ay4axn--uist22hamurakam" +
"igoris-a-gurunusualpersonxn--uisz3gxn--unjrga-rtarumizusawaxn--u" +
"nup4yxn--uuwu58axn--vads-jraxn--valle-aoste-ebbtuscanyxn--valle-" +
"d-aoste-ehbodoes-itcouldbeworldxn--valleaoste-e7axn--valledaoste" +
"-ebbvadsoccertmgrazerbaijan-mayengerdalcesvizzeraxn--vard-jraxn-" +
"-vegrshei-c0axn--vermgensberater-ctbitsvn-reposouthcarolinarviko" +
"monoticiashowaxn--vermgensberatung-pwblogoiplatter-appinkomatsus" +
"himarumorimachidaxn--vestvgy-ixa6oxn--vg-yiabkhaziaxn--vgan-qoax" +
"n--vgsy-qoa0jelenia-goraxn--vgu402colognexus-3xn--vhquvestvagoyx" +
"n--vler-qoaxn--vre-eiker-k8axn--vrggt-xqadxn--vry-yla5gxn--vuq86" +
"1bilbaokinawashirosatobishimagentositecnologiazurewebsiteshikaga" +
"miishibukawakkanaibetsubamericanfamilydsmynasushiobarackmazeplay" +
"okozebinagisochildrensgardenaval-d-aosta-valleyolasitebinordland" +
"evelopmentatsunobninskaracoldwarszawaustevollillyboltateshinanom" +
"achimkentateyamajudygarlanddnskingitpagefrontappalmspringsakeret" +
"rosnubaltimore-og-romsdalp1xn--w4r85el8fhu5dnraxn--w4rs40lxn--wc" +
"vs22dxn--wgbh1colonialwilliamsburgroundhandlingroznyxn--wgbl6axn" +
"--xhq521billustrationrenderxn--xkc2al3hye2axn--xkc2dl3a5ee0hands" +
"onyxn--y9a3aquariumintereisenxn--yer-znaturhistorischeswidnicart" +
"oonartdecologiaxn--yfro4i67oxn--ygarden-p1axn--ygbi2ammxn--45br5" +
"cylxn--ystre-slidre-ujbiocpanamatsushigexn--zbx025dxn--zf0ao64ax" +
"n--zf0avxlxn--zfr164bipanasonicasertaipeidsvollombardiadembetsuk" +
"ubankaratexnbayxz"
// nodes is the list of nodes. Each node is represented as a uint32, which
// encodes the node's children, wildcard bit and node type (as an index into
// the children array), ICANN bit and text.
//
// If the table was generated with the -comments flag, there is a //-comment
// after each node's data. In it is the nodes-array indexes of the children,
// formatted as (n0x1234-n0x1256), with * denoting the wildcard bit. The
// nodeType is printed as + for normal, ! for exception, and o for parent-only
// nodes that have children but don't match a domain label in their own right.
// An I denotes an ICANN domain.
//
// The layout within the uint32, from MSB to LSB, is:
// [ 0 bits] unused
// [10 bits] children index
// [ 1 bits] ICANN bit
// [15 bits] text index
// [ 6 bits] text length
var nodes = [...]uint32{
0x3346c3,
0x358784,
0x2ed746,
0x21cb43,
0x21cb46,
0x399c86,
0x3c3043,
0x221ec4,
0x205687,
0x2ed388,
0x1a000c2,
0x1f44d87,
0x385a09,
0x2e460a,
0x2e460b,
0x238883,
0x241b45,
0x2204502,
0x204504,
0x2cdbc3,
0x252f05,
0x2602142,
0x36c683,
0x2a20c04,
0x202145,
0x2e03702,
0x219e8e,
0x267743,
0x3bdcc6,
0x3203f42,
0x2ed8c7,
0x244206,
0x3603802,
0x2979c3,
0x235c86,
0x21d4c8,
0x29e686,
0x3aa2c4,
0x3a00b02,
0x354109,
0x224ac7,
0x3804c6,
0x3704c9,
0x391a48,
0x24fcc4,
0x349446,
0x3d4146,
0x3e01902,
0x2fe906,
0x218e0f,
0x3e960e,
0x311c44,
0x228685,
0x339845,
0x3b1ec9,
0x24a949,
0x236487,
0x207a06,
0x207943,
0x4204302,
0x216183,
0x2b990a,
0x4604d03,
0x347a45,
0x314102,
0x3ac849,
0x4e01d42,
0x20ad44,
0x2ffcc6,
0x258405,
0x37ce44,
0x5721084,
0x205d83,
0x241004,
0x5a016c2,
0x300b84,
0x5e02084,
0x35030a,
0x6200882,
0x2631c7,
0x2339c8,
0x7a0c502,
0x33e407,
0x237c44,
0x36ddc7,
0x237c45,
0x387787,
0x35ca86,
0x2a1784,
0x3b9245,
0x27a907,
0x9218682,
0x2fea83,
0x9620102,
0x3dabc3,
0x9a0f202,
0x289b85,
0x9e00202,
0x37fe84,
0x23cfc5,
0x311b87,
0x30420e,
0x2ca444,
0x28fac4,
0x204243,
0x324fc9,
0x2ec50b,
0x2fd348,
0x335848,
0x33b708,
0x3d6448,
0xa37030a,
0x387687,
0x2542c6,
0xa61cb82,
0x378743,
0x3e0b43,
0x3e2084,
0x378783,
0x397143,
0x1740a82,
0xaa02742,
0x292d05,
0x35a086,
0x2aa1c4,
0x3a9487,
0x251c86,
0x2da804,
0x3c5787,
0x202743,
0xb6e7fc2,
0xba1da82,
0xbe16c02,
0x21db46,
0xc200282,
0x3676c5,
0x341fc3,
0x3dc584,
0x305544,
0x305545,
0x3f2583,
0xc60bec3,
0xca0aa82,
0x20e485,
0x20e48b,
0x30f70b,
0x211d44,
0x20ed49,
0x20fdc4,
0xce10482,
0x210cc3,
0x211243,
0xd211f02,
0x216f8a,
0xd602642,
0x204785,
0x2f8cca,
0x24f984,
0x2139c3,
0x2153c4,
0x218043,
0x218044,
0x218047,
0x219285,
0x21a286,
0x21ae86,
0x21cbc3,
0x2234c8,
0x215a03,
0xda03ac2,
0x365d08,
0x29e90b,
0x22c908,
0x22d286,
0x22d907,
0x22f608,
0xf201002,
0xf629b02,
0x27f688,
0x23b007,
0x213f05,
0xfb1cc08,
0xffb11c8,
0x285f03,
0x235504,
0x399d02,
0x10235982,
0x1060b282,
0x10e36f02,
0x236f03,
0x11203d82,
0x315983,
0x254ac4,
0x203d83,
0x24fc84,
0x25198b,
0x2063c3,
0x301806,
0x26c004,
0x2d85ce,
0x3259c5,
0x279e08,
0x3bddc7,
0x3bddca,
0x23c843,
0x358587,
0x2ec6c5,
0x23c844,
0x266e86,
0x266e87,
0x376204,
0x1171c644,
0x3f3784,
0x251584,
0x209f46,
0x213cc3,
0x213cc8,
0x21ff08,
0x2a55c3,
0x216f43,
0x34d4c4,
0x35ee03,
0x11e06282,
0x12227e82,
0x205206,
0x349543,
0x27b604,
0x12611582,
0x211583,
0x23d283,
0x21f9c2,
0x12a045c2,
0x2e0c86,
0x22ad87,
0x233747,
0x2fc645,
0x3b7c84,
0x2e0085,
0x2d5187,
0x3594c9,
0x3b1646,
0x2fc546,
0x13a12f82,
0x320588,
0x32c046,
0x333c45,
0x317507,
0x3bb044,
0x3bb045,
0x3bf004,
0x3bf008,
0x13e02882,
0x14200482,
0x38e506,
0x200488,
0x3402c5,
0x357386,
0x361608,
0x3653c8,
0x14605985,
0x1722f8c4,
0x2849c7,
0x17607e42,
0x17b6e3c2,
0x18e0b642,
0x2ffdc5,
0x19a9a145,
0x27a446,
0x3dafc7,
0x3e6887,
0x19e1a043,
0x34af07,
0x28f9c8,
0x27a38d49,
0x21a047,
0x239447,
0x34be48,
0x239fc6,
0x23c346,
0x23e30c,
0x24000a,
0x2404c7,
0x241a0b,
0x242707,
0x24270e,
0x27e43444,
0x243544,
0x245687,
0x38df47,
0x249e06,
0x249e07,
0x33bfc7,
0x288583,
0x28203682,
0x24c806,
0x24c80a,
0x24d24b,
0x24e8c7,
0x24f505,
0x250943,
0x250cc6,
0x250cc7,
0x21d9c3,
0x28600102,
0x2512ca,
0x28b347c2,
0x28fa8a82,
0x2924a282,
0x2963cc82,
0x254705,
0x255504,
0x2a203402,
0x300c05,
0x24d843,
0x3cabc5,
0x205104,
0x22f4c4,
0x2e3a86,
0x267ac6,
0x20e683,
0x3d8a84,
0x35cd43,
0x2b2101c2,
0x22dc84,
0x22dc86,
0x25bb85,
0x2bc906,
0x317608,
0x215b84,
0x3289c8,
0x38f745,
0x294ec8,
0x2de106,
0x318747,
0x282a44,
0x2c682a46,
0x2ca24dc3,
0x3ad7c3,
0x2c5608,
0x33c744,
0x2ce15487,
0x28b246,
0x2f55c9,
0x36ea08,
0x371dc8,
0x37b1c4,
0x223403,
0x2304c2,
0x2d664842,
0x2da30902,
0x329e83,
0x2de057c2,
0x21d944,
0x29ef86,
0x241543,
0x2d1ec7,
0x20cec3,
0x2ca508,
0x231645,
0x2724c3,
0x23cf45,
0x23d084,
0x3bad46,
0x2366c6,
0x311ac6,
0x2e2904,
0x242ac3,
0x2e217e02,
0x2e642185,
0x200843,
0x2ee060c2,
0x21c0c3,
0x300a45,
0x2f226783,
0x2fa410c9,
0x2fe00942,
0x30612002,
0x29fe85,
0x221206,
0x2bd3c6,
0x3171c8,
0x3171cb,
0x34fb0b,
0x2fc845,
0x2e8549,
0x1601082,
0x2cee08,
0x20f044,
0x30e01b42,
0x346043,
0x316e82c6,
0x31a02182,
0x3d6a48,
0x31e0a842,
0x2738ca,
0x32679783,
0x32f86046,
0x31de08,
0x221b86,
0x396707,
0x219007,
0x3d3cca,
0x24fa04,
0x36c404,
0x385109,
0x333bd905,
0x219ec6,
0x2115c3,
0x2872c4,
0x33601d04,
0x201d07,
0x33bae987,
0x264f44,
0x2424c5,
0x27a508,
0x256007,
0x256287,
0x33e1b5c2,
0x2ae1c4,
0x2a99c8,
0x259284,
0x25d444,
0x25d845,
0x25d987,
0x34b68049,
0x23be84,
0x25f649,
0x2607c8,
0x262104,
0x262107,
0x264643,
0x265cc7,
0x34e00bc2,
0x16ccd82,
0x266946,
0x2c48c7,
0x2672c4,
0x268887,
0x269387,
0x26a303,
0x352698c2,
0x215ac2,
0x26b7c3,
0x26b7c4,
0x26b7cb,
0x335948,
0x215ac4,
0x26ca05,
0x26e147,
0x2fa885,
0x34deca,
0x270903,
0x35605b02,
0x2727c4,
0x274309,
0x277c03,
0x277cc7,
0x244b49,
0x20e288,
0x203743,
0x291e47,
0x244603,
0x299704,
0x29adc9,
0x29dc86,
0x32b303,
0x203f82,
0x2ccb83,
0x2ccb87,
0x39ab45,
0x3a3c06,
0x2d1704,
0x39b945,
0x2927c3,
0x21f0c6,
0x2094c3,
0x20ef42,
0x25c904,
0x35a03942,
0x35f339c3,
0x36206582,
0x243b43,
0x21b304,
0x25a807,
0x2a8606,
0x201cc2,
0x36601c82,
0x372004,
0x36e181c2,
0x37203d02,
0x2af084,
0x2af085,
0x20db45,
0x3d4d06,
0x37607282,
0x370985,
0x3dccc5,
0x207283,
0x2feb46,
0x2140c5,
0x21dac2,
0x363205,
0x21dac4,
0x222343,
0x222583,
0x37a0e002,
0x27ab07,
0x26e304,
0x26e309,
0x2871c4,
0x299fc3,
0x2c97c8,
0x37e99fc4,
0x299fc6,
0x2bc303,
0x23f783,
0x20f583,
0x3830f1c2,
0x317442,
0x38600642,
0x343e08,
0x2157c8,
0x3c9706,
0x3b6e45,
0x230185,
0x349707,
0x38a62fc5,
0x216e82,
0x38eaca82,
0x39200042,
0x28f288,
0x3204c5,
0x309c84,
0x242e05,
0x24ad47,
0x3df244,
0x25aec2,
0x3963ff82,
0x35a8c4,
0x362607,
0x2a0407,
0x387744,
0x3e1243,
0x2a5504,
0x2a5508,
0x39a3c686,
0x266d0a,
0x3af884,
0x2a9408,
0x242344,
0x22da06,
0x2aca44,
0x3000c6,
0x26e5c9,
0x2bba87,
0x3a80c3,
0x39e01742,
0x2830c3,
0x210682,
0x3a209bc2,
0x257c86,
0x28adc8,
0x2bd547,
0x317a89,
0x2bd709,
0x2bf805,
0x2c0d09,
0x2c2005,
0x2c3205,
0x2c3fc8,
0x3a616c44,
0x3aa16c47,
0x239803,
0x2c41c7,
0x239806,
0x2c4e47,
0x2bb585,
0x2390c3,
0x3ae30fc2,
0x213c04,
0x3b20e9c2,
0x3b607142,
0x376406,
0x233945,
0x2c7e07,
0x33be43,
0x3d6e44,
0x213903,
0x23ad43,
0x3ba06502,
0x3c202502,
0x399d84,
0x269883,
0x30e905,
0x3c613f82,
0x3ce04182,
0x3a0fc6,
0x304144,
0x310f44,
0x310f4a,
0x3d6005c2,
0x20f2c3,
0x22838a,
0x231a48,
0x3da5c204,
0x2005c3,
0x251a83,
0x2d1fc9,
0x27cfc9,
0x231c06,
0x3de0bc83,
0x23bb4d,
0x23dbc6,
0x2497cb,
0x3e20b882,
0x349288,
0x432235c2,
0x43603202,
0x2c6405,
0x43a040c2,
0x2b3307,
0x209a83,
0x214288,
0x43e01ac2,
0x32a7c4,
0x22cc83,
0x24d946,
0x22b9c4,
0x216f03,
0x45202382,
0x2fc7c4,
0x2cb785,
0x2cc787,
0x290943,
0x2cd143,
0x1626b42,
0x2cd803,
0x2cde03,
0x45600c02,
0x279504,
0x242cc6,
0x363983,
0x2ce203,
0x45a5cf02,
0x25cf08,
0x2cf5c4,
0x2206c6,
0x393f87,
0x391d06,
0x2c5584,
0x53e01782,
0x2396cb,
0x3cdfce,
0x222f8f,
0x2e0403,
0x546dbe82,
0x164f082,
0x54a04082,
0x2b6103,
0x3cc144,
0x220243,
0x359746,
0x248286,
0x2b46c7,
0x390e44,
0x54e21342,
0x55232ac2,
0x309345,
0x3e4e07,
0x3cedc6,
0x5567a6c2,
0x390744,
0x2d4783,
0x55a0af02,
0x55f82443,
0x2d5b84,
0x2dbdc9,
0x562e3dc2,
0x5661c4c2,
0x259605,
0x56ae42c2,
0x57203e02,
0x3698c7,
0x385c8b,
0x218dc5,
0x2682c9,
0x26f6c6,
0x57609004,
0x379289,
0x377647,
0x393347,
0x237b43,
0x2fe046,
0x37ea87,
0x21e803,
0x2b93c6,
0x57e16202,
0x5820b602,
0x21cd43,
0x3aca05,
0x3b14c7,
0x248386,
0x39aac5,
0x26e284,
0x2ba945,
0x3141c4,
0x58609a42,
0x2e2544,
0x2d4544,
0x3a73cd,
0x2d4549,
0x260e88,
0x259884,
0x3ebb05,
0x3b80c7,
0x3d1184,
0x370c87,
0x22c4c5,
0x58abea84,
0x2be3c5,
0x58e768c4,
0x31a606,
0x3dadc5,
0x592032c2,
0x336a83,
0x251f83,
0x2459c4,
0x2459c5,
0x20d706,
0x38de05,
0x26eb44,
0x59713103,
0x59a14746,
0x223d05,
0x225845,
0x3daec4,
0x304c03,
0x3af90c,
0x59ecc882,
0x5a200b42,
0x5a612a82,
0x222043,
0x222044,
0x5aa0fe02,
0x302888,
0x22be04,
0x3301c6,
0x5ae24902,
0x5b216902,
0x5b603f02,
0x2a4a45,
0x300346,
0x238044,
0x2361c6,
0x212506,
0x26ac03,
0x5ba9d60a,
0x299f05,
0x2b98c3,
0x213606,
0x5be13609,
0x22e147,
0x3c8548,
0x391909,
0x3bfe88,
0x2a3c46,
0x20a2c3,
0x5c205942,
0x3b0148,
0x5c6593c2,
0x5ca00ec2,
0x2384c3,
0x2fc3c5,
0x2b1244,
0x2bdf89,
0x23ca84,
0x255308,
0x5d20b4c3,
0x5d66b484,
0x221248,
0x5da15142,
0x23d8c2,
0x3397c5,
0x3bba89,
0x214e43,
0x32eb84,
0x3f0484,
0x2202c3,
0x29558a,
0x5df9b302,
0x5e213a42,
0x2e7f43,
0x39d383,
0x161c182,
0x377f43,
0x5e62ab02,
0x5ea01942,
0x5ee30944,
0x296ac6,
0x281884,
0x28f0c3,
0x3da783,
0x5f30c783,
0x24d5c6,
0x339b85,
0x2eba87,
0x2eb9c6,
0x2ec108,
0x2ec306,
0x201944,
0x2b2dcb,
0x2eea43,
0x2eea45,
0x5f60ffc2,
0x369bc2,
0x5fa54782,
0x5fe0d3c2,
0x221383,
0x60282182,
0x282183,
0x2f0343,
0x60a067c2,
0x60ef3c06,
0x2f4005,
0x2b7346,
0x6127c082,
0x61611282,
0x61a225c2,
0x61e736c2,
0x622130c2,
0x62602202,
0x21c603,
0x3a9686,
0x62a25a04,
0x3b52c6,
0x2907c4,
0x2ec4c3,
0x63603642,
0x201f42,
0x238cc3,
0x63a14883,
0x3cec47,
0x3dacc7,
0x6965c3c7,
0x316147,
0x218943,
0x69a7a004,
0x327e04,
0x327e0a,
0x3e69c5,
0x69e31a82,
0x268843,
0x6a200602,
0x262243,
0x283083,
0x6aa00582,
0x28f944,
0x349904,
0x3cb645,
0x32bd85,
0x311f06,
0x311186,
0x6ae18882,
0x6b2025c2,
0x2fb405,
0x2b7052,
0x326ac6,
0x22a783,
0x22a786,
0x269b85,
0x1616fc2,
0x73611f42,
0x336783,
0x211f43,
0x2ac1c3,
0x73a17a02,
0x21fe83,
0x73e07982,
0x230983,
0x37b608,
0x248803,
0x248806,
0x3e8187,
0x3271c6,
0x3271cb,
0x290707,
0x313084,
0x74600e82,
0x3a3b45,
0x74a14843,
0x247043,
0x20b8c5,
0x218843,
0x75218846,
0x2ac403,
0x203584,
0x2003c6,
0x334046,
0x7564acc3,
0x285c07,
0x244747,
0x2b54c5,
0x24eb06,
0x21cc03,
0x782cebc3,
0x78607002,
0x78a30704,
0x3f3589,
0x21b645,
0x3af684,
0x303a08,
0x23d505,
0x78e407c5,
0x24f689,
0x380583,
0x3dca84,
0x792035c2,
0x221583,
0x79681142,
0x281146,
0x168e5c2,
0x79a15882,
0x2a4948,
0x2a54c3,
0x2be307,
0x39fc85,
0x2fddc5,
0x331a0b,
0x2fddc6,
0x331c06,
0x24bb04,
0x218386,
0x79f00dc8,
0x26c0c3,
0x274003,
0x274004,
0x3e4d44,
0x304e07,
0x31ea05,
0x7a324e02,
0x7a608782,
0x7ae08785,
0x2e6ac4,
0x2e6acb,
0x305448,
0x268f84,
0x7b25cf42,
0x7b609ec2,
0x209ec3,
0x306744,
0x306a05,
0x307387,
0x7bb097c4,
0x21bd84,
0x7be05442,
0x38a3c9,
0x30a905,
0x219085,
0x30b185,
0x7c205443,
0x244e04,
0x244e0b,
0x30be44,
0x30c10b,
0x30c6c5,
0x2230ca,
0x30ce88,
0x30d08a,
0x30d883,
0x30d88a,
0x7ca1b482,
0x7ce21e42,
0x7d229a83,
0x7d6cc442,
0x310c43,
0x7db129c2,
0x7df42742,
0x313e44,
0x223606,
0x235f05,
0x317483,
0x23b886,
0x212c85,
0x235804,
0x7e200902,
0x21d784,
0x2e81ca,
0x2cb0c7,
0x351e86,
0x2516c7,
0x24c843,
0x2d5bc8,
0x34c64b,
0x226445,
0x3f05c5,
0x3f05c6,
0x304704,
0x236d08,
0x2221c3,
0x28b8c4,
0x3d4047,
0x312cc6,
0x346906,
0x2d840a,
0x25f6c4,
0x2a1a8a,
0x7e6f7b86,
0x2f7b87,
0x26ca87,
0x28db44,
0x28db49,
0x230dc5,
0x377483,
0x236883,
0x7ea06f83,
0x234344,
0x7ee00682,
0x366906,
0x7f2d9445,
0x22a9c5,
0x246646,
0x215084,
0x7f601a42,
0x246744,
0x7fe03b02,
0x379105,
0x230f44,
0x8122ea03,
0x81611f82,
0x211f83,
0x3bb206,
0x81a02fc2,
0x339288,
0x22dfc4,
0x22dfc6,
0x39dc06,
0x81e6e204,
0x220f05,
0x22f7c8,
0x230007,
0x286287,
0x28628f,
0x2a98c6,
0x247943,
0x249f84,
0x234c03,
0x22db44,
0x3a23c4,
0x8220b242,
0x2625c3,
0x33fc03,
0x82606382,
0x206383,
0x21da03,
0x21930a,
0x31cdc7,
0x3ae24c,
0x3ae506,
0x25dd06,
0x269507,
0x82a6ffc7,
0x272589,
0x82f65e44,
0x836213c2,
0x83a01042,
0x2d87c6,
0x285a04,
0x2db286,
0x277f48,
0x3acac4,
0x33a6c6,
0x2bd385,
0x842833c8,
0x250dc3,
0x287385,
0x28d283,
0x219183,
0x219184,
0x272983,
0x846291c2,
0x84a00e02,
0x377349,
0x2936c5,
0x293a44,
0x29f705,
0x20f144,
0x2eadc7,
0x3637c5,
0x85223984,
0x302308,
0x2cf686,
0x2d4a04,
0x2d4a08,
0x85601a82,
0x2dc104,
0x31d504,
0x354fc7,
0x85a01a84,
0x202342,
0x85e14942,
0x220203,
0x259504,
0x243a83,
0x396bc5,
0x8621e7c2,
0x2f93c5,
0x2827c2,
0x319cc5,
0x2e6805,
0x8662c602,
0x23d204,
0x86a075c2,
0x3e21c6,
0x212f06,
0x3bbbc8,
0x29c8c8,
0x376384,
0x300f85,
0x312649,
0x2cef44,
0x3effc4,
0x27c243,
0x289f03,
0x86e89f05,
0x26ed05,
0x29a244,
0x2a7382,
0x334a03,
0x87206342,
0x87601b82,
0x338d45,
0x28d107,
0x20d944,
0x391b09,
0x2e8309,
0x28e403,
0x28e408,
0x2ab4c9,
0x3d3b47,
0x87b3a505,
0x35d3c6,
0x35da06,
0x35eec5,
0x2d4645,
0x87e02802,
0x202805,
0x2e0788,
0x2e1306,
0x8830c907,
0x3ae8c4,
0x2df487,
0x3a8246,
0x88609202,
0x20d406,
0x31934a,
0x319bc5,
0x88a15982,
0x88e37dc2,
0x27fe06,
0x892a05c7,
0x89603382,
0x221e83,
0x3f38c6,
0x2de1c4,
0x253846,
0x324bc6,
0x20184a,
0x336e05,
0x3c7b06,
0x3c8703,
0x3c8704,
0x89a05e02,
0x32c003,
0x89e22082,
0x32bc83,
0x8a228604,
0x2dfc04,
0x8a7b188a,
0x219d83,
0x387c47,
0x3de4c6,
0x328b44,
0x2372c2,
0x2184c2,
0x8aa007c2,
0x2ef983,
0x26c847,
0x2007c7,
0x29b784,
0x220d87,
0x307486,
0x23b147,
0x21dc44,
0x223f05,
0x2031c5,
0x8ae09b02,
0x226b06,
0x22b203,
0x231282,
0x231286,
0x8b229b42,
0x8b649902,
0x254905,
0x8ba021c2,
0x8be019c2,
0x398c45,
0x2eed85,
0x313b85,
0x8c673143,
0x2f2505,
0x2fde87,
0x2bb945,
0x336fc5,
0x279f04,
0x240646,
0x253004,
0x8ca008c2,
0x8d6d0e85,
0x215e07,
0x203788,
0x27b8c6,
0x27b8cd,
0x27cd89,
0x27cd92,
0x33c805,
0x3465c3,
0x8da0ea02,
0x3247c4,
0x23dc43,
0x38a6c5,
0x31a945,
0x8de2ccc2,
0x272503,
0x8e25c442,
0x8ea2b942,
0x8ee00082,
0x3f4005,
0x3a81c3,
0x8f20dfc2,
0x8f60ba42,
0x28f906,
0x26b54a,
0x22a743,
0x245943,
0x2ed243,
0x91203342,
0x9fa096c2,
0xa0203b42,
0x207882,
0x334809,
0x2e31c4,
0x283dc8,
0xa0627e42,
0xa0e01102,
0x271dc5,
0x241e48,
0x24d048,
0x2f29cc,
0x246143,
0xa1276282,
0xa160b382,
0x2dac86,
0x31be45,
0x2f4e83,
0x26aa06,
0x31bf86,
0x251a43,
0x31d443,
0x31d886,
0x31f304,
0x2637c6,
0x3afc04,
0x31f9c4,
0x32134a,
0xa1a561c2,
0x2647c5,
0x32290a,
0x322845,
0x323904,
0x323a06,
0x323b84,
0x221846,
0xa1e02402,
0x21c7c6,
0x325785,
0x3c7987,
0x3d0286,
0x269704,
0x2f5107,
0x20d445,
0x2477c7,
0x22abc7,
0x22abce,
0x290106,
0x248b85,
0x2080c7,
0x3dcb47,
0x212105,
0x2152c4,
0x333502,
0x28ac87,
0x28d304,
0x260644,
0x2d568b,
0xa22270c3,
0x30dcc7,
0x2270c4,
0x30dfc7,
0x224303,
0x35680d,
0x328848,
0xa2656bc4,
0x256bc5,
0x3e1685,
0x329083,
0xa2a2dec2,
0x32bfc3,
0x32c803,
0x2159c4,
0x226c85,
0x226d87,
0x3c8786,
0x39b403,
0x2313cb,
0x377b8b,
0x2b87cb,
0x2c144b,
0x2c1d8a,
0x3cce4b,
0x3012cb,
0x31c20c,
0x31fdcb,
0x36a851,
0x37e70a,
0x3c120b,
0x3f1dcc,
0x32d34b,
0x32e2ca,
0x32e94a,
0x32fd0e,
0x33034b,
0x33060a,
0x331d91,
0x3321ca,
0x3326cb,
0x332c0e,
0x334acc,
0x334f4b,
0x33520e,
0x33558c,
0x33750a,
0x33870c,
0xa2f3948a,
0x339cc8,
0x33a989,
0x33c9ca,
0x33cc4a,
0x33cecb,
0x33f38e,
0x33fed1,
0x34a749,
0x34a98a,
0x34b6cb,
0x34cd4d,
0x34dbca,
0x34e396,
0x34f70b,
0x350b8a,
0x3514ca,
0x35250b,
0x353f89,
0x357189,
0x358b0d,
0x35994b,
0x35b40b,
0x35b8c9,
0x35bf0e,
0x35c54a,
0x35d18a,
0x35d7ca,
0x35decb,
0x35e70b,
0x35f98d,
0x36130d,
0x362e90,
0x36334b,
0x363e4c,
0x36514b,
0x3693cb,
0x36ce0e,
0x36e0cb,
0x36e0cd,
0x3745cb,
0x37504f,
0x37540b,
0x375dca,
0x377889,
0x37a2c9,
0xa337a64b,
0x37a90e,
0x37ac8e,
0x37c54b,
0x37d2cf,
0x38078b,
0x380a4b,
0x380d0a,
0x385889,
0x38820f,
0x38d40c,
0x38d9cc,
0x38e94e,
0x38ef8f,
0x38f34e,
0x38fd10,
0x39010f,
0x39110e,
0x391fcc,
0x3922d1,
0x392712,
0x393b11,
0x39414e,
0x39498b,
0x39498e,
0x394d0f,
0x3950ce,
0x395450,
0x395853,
0x395d11,
0x39614c,
0x39644e,
0x3968cc,
0x396d13,
0x3977d0,
0x397c4c,
0x397f4c,
0x39880b,
0x39998e,
0x399e8b,
0x39a5cb,
0x39bc8c,
0x3a280a,
0x3a2c4c,
0x3a2f4c,
0x3a3249,
0x3a560b,
0x3a58c8,
0x3a6089,
0x3a608f,
0x3a7acb,
0xa37a890a,
0x3ab34c,
0x3ac28b,
0xa3bac549,
0x3ad1c8,
0x3ad58b,
0x3aee0a,
0x3af08a,
0x3af30b,
0x3afecc,
0x3b1b09,
0x3b1d48,
0x3b464b,
0x3b6f8b,
0x3bcd0e,
0x3be20b,
0x3c0b8b,
0x3cc50b,
0x3cc7c9,
0x3cd3cd,
0x3dfeca,
0x3e3357,
0x3e4398,
0x3e6b89,
0x3e7dcb,
0x3ed6d4,
0x3edbcb,
0x3ee14a,
0x3eed0a,
0x3eef8b,
0x3ef6d0,
0x3efad1,
0x3f00ca,
0x3f13cd,
0x3f1acd,
0x3f328b,
0x226c03,
0xa3e05503,
0x21a846,
0x209545,
0x2f0b07,
0x2c6b06,
0xa420b2c2,
0x2c0209,
0x23b684,
0x2fcdc8,
0x206ec3,
0x324707,
0xa4603482,
0x2c7e43,
0xa4a079c2,
0x2e8dc6,
0x2e9b84,
0x230ac4,
0x204e83,
0xa52e4302,
0xa562fd04,
0x28da87,
0xa5a371c2,
0x21a043,
0x358c3,
0x226783,
0x20f583,
0x214e43,
0x214883,
0x24acc3,
0x113508,
0x208c43,
0x2000c2,
0x1c3448,
0x20b642,
0x20f583,
0x214e43,
0x214883,
0x24acc3,
0x219303,
0x345796,
0x373113,
0x220c09,
0x2848c8,
0x3a39c9,
0x322a86,
0x35a910,
0x3d24d3,
0x312d88,
0x291087,
0x29ba47,
0x2ba68a,
0x3b95c9,
0x336809,
0x265a0b,
0x35ca86,
0x335a4a,
0x22d286,
0x23a103,
0x27aa45,
0x213cc8,
0x29464d,
0x2ffe8c,
0x325447,
0x3bc70d,
0x22f8c4,
0x23e08a,
0x23fb4a,
0x24000a,
0x2ae887,
0x249c47,
0x24e084,
0x282a46,
0x325944,
0x226788,
0x23cac9,
0x3171c6,
0x3171c8,
0x25248d,
0x2e8549,
0x31de08,
0x219007,
0x254b4a,
0x2c48c6,
0x3766c4,
0x212747,
0x366b0a,
0x3ee84e,
0x262fc5,
0x2a014b,
0x2ef6c9,
0x27cfc9,
0x2098c7,
0x2098ca,
0x36df07,
0x3ce109,
0x233e08,
0x20bc0b,
0x2fc3c5,
0x260d4a,
0x222389,
0x370e0a,
0x20700b,
0x21264b,
0x265795,
0x2dbfc5,
0x219085,
0x244e0a,
0x27468a,
0x36f207,
0x2190c3,
0x2d8748,
0x2f2d4a,
0x22dfc6,
0x271ec9,
0x2833c8,
0x2d4a04,
0x28e189,
0x29c8c8,
0x2de047,
0x2d0e86,
0x215e07,
0x2cfb07,
0x24d3c5,
0x262e0c,
0x256bc5,
0x21a043,
0x226783,
0x20f583,
0x214883,
0x24acc3,
0x20b642,
0x21a043,
0x214883,
0x208c43,
0x24acc3,
0x21a043,
0x214883,
0x248803,
0x24acc3,
0x1e0283,
0x1c3448,
0x21a043,
0x226783,
0x20f583,
0x214e43,
0x214883,
0x24acc3,
0x1c3448,
0x20b642,
0x21a043,
0x238b87,
0x33f84,
0x214883,
0x3b284,
0x24acc3,
0x12c85,
0x20b642,
0x203142,
0x313002,
0x201ac2,
0x203cc2,
0x20ea82,
0x1874a,
0x12c105,
0x12c10a,
0x152aa49,
0x14bd4b,
0x5f887,
0x1bc3c6,
0xa5286,
0x67409,
0x12b1c7,
0x3504,
0x14a150a,
0x1540e,
0x134309,
0x482ea03,
0x9e747,
0x152986,
0xf83,
0x127dc5,
0xc1,
0x521a043,
0x226783,
0x204703,
0x20f583,
0x20bc83,
0x214e43,
0x2f4006,
0x214883,
0x24acc3,
0x23ae43,
0x1c3448,
0x200984,
0x26b247,
0x204ec3,
0x271984,
0x206f43,
0x209943,
0x20f583,
0xf5d87,
0x1bfd04,
0x2d03,
0x1bee85,
0x66000c2,
0xbec3,
0x6a0b642,
0x6e99909,
0x709f509,
0x9fa0d,
0x9fd4d,
0x313002,
0x5c204,
0x1beec9,
0x10210c,
0x2003c2,
0x765c108,
0x10b844,
0x32b843,
0x1c3448,
0x8d304,
0x1419002,
0x14005c2,
0x1419002,
0x151fbc6,
0x2405c3,
0x2507c3,
0x7e1a043,
0x23e084,
0x8626783,
0x8e0f583,
0x206502,
0x25c204,
0x214883,
0x2100c3,
0x201802,
0x24acc3,
0x225542,
0x313783,
0x202fc2,
0x201683,
0x224e43,
0x20d442,
0x1c3448,
0x82a2449,
0x10210c,
0x29083,
0x2405c3,
0x21ff08,
0x8a100c3,
0x201802,
0x313783,
0x202fc2,
0x201683,
0x224e43,
0x20d442,
0x3ae507,
0x313783,
0x202fc2,
0x201683,
0x224e43,
0x20d442,
0x21a043,
0x2742,
0x13cc3,
0x1b42,
0xa842,
0x1c82,
0x5942,
0x3342,
0x5502,
0x20bec3,
0x21a043,
0x226783,
0x20f583,
0x25c204,
0x20bc83,
0x214e43,
0x225a04,
0x214883,
0x24acc3,
0x204d42,
0x205443,
0x1c3448,
0x21a043,
0x226783,
0x20f583,
0x214e43,
0x214883,
0x24acc3,
0x1a42,
0xc503,
0x7982,
0x20bec3,
0x20b642,
0x21a043,
0x226783,
0x20f583,
0x25c204,
0x214883,
0x24acc3,
0x33a505,
0x22ccc2,
0x2000c2,
0x1c3448,
0xaf12412,
0xb2d9f88,
0x10210c,
0x1470708,
0x16b8a,
0x5985,
0x53c7,
0x20f583,
0x201601,
0x2009c1,
0x202d01,
0x201501,
0x200a41,
0x22d881,
0x200a01,
0x205c41,
0x24a501,
0x200001,
0x2000c1,
0x200201,
0x14f985,
0x1c3448,
0x200101,
0x200cc1,
0x200501,
0x200bc1,
0x200041,
0x200801,
0x200181,
0x200c01,
0x200701,
0x2004c1,
0x200ec1,
0x200581,
0x2003c1,
0x2015c1,
0x207a81,
0x200401,
0x200741,
0x2007c1,
0x200081,
0x201101,
0x200f81,
0x202d81,
0x203481,
0x2033c1,
0x21a043,
0x226783,
0x20f583,
0x214883,
0x24acc3,
0x20b642,
0x21a043,
0x226783,
0x2003c2,
0x24acc3,
0xf5d87,
0x89207,
0x38286,
0x473ca,
0x9e208,
0x6bd08,
0x6c747,
0xc8b04,
0x177f46,
0xfaf05,
0x1a4045,
0xb8743,
0x1b506,
0x5f986,
0x265a04,
0x33e2c7,
0x1c3448,
0x2eef84,
0x21a043,
0x226783,
0x20f583,
0x214883,
0x24acc3,
0xb642,
0x21a043,
0x226783,
0x20f583,
0x214883,
0x24acc3,
0x339688,
0x3496c4,
0x241004,
0x211d44,
0x2dab87,
0x2f1a07,
0x21a043,
0x24354b,
0x3b43ca,
0x3a9b07,
0x3f11c8,
0x21e908,
0x226783,
0x33ba07,
0x204703,
0x217b48,
0x225d89,
0x25c204,
0x20bc83,
0x297b48,
0x214e43,
0x2eeb8a,
0x2f4006,
0x3b52c7,
0x214883,
0x2fe146,
0x3e4088,
0x24acc3,
0x25e906,
0x30568d,
0x3070c8,
0x30be4b,
0x30f646,
0x20d847,
0x223305,
0x3e890a,
0x365905,
0x26ec0a,
0x22ccc2,
0x200f83,
0x260644,
0x200006,
0x3c3043,
0x2b3c83,
0x2332c3,
0x23ac83,
0x3ec3c3,
0x201902,
0x3a52c5,
0x2bfbc9,
0x204d03,
0x24da43,
0x205d83,
0x20cb03,
0x200201,
0x2ced07,
0x2f2345,
0x3ca803,
0x262603,
0x3f2583,
0x211d44,
0x33be83,
0x214188,
0x377ac3,
0x31c8cd,
0x2901c8,
0x2200c6,
0x304103,
0x38bc43,
0x3af583,
0xde1a043,
0x240908,
0x243544,
0x24a083,
0x24e8c3,
0x200106,
0x252c48,
0x242ec3,
0x220ac3,
0x2c5383,
0x224dc3,
0x3e8943,
0x21c0c3,
0x226783,
0x20ff83,
0x25aa43,
0x265883,
0x2307c3,
0x340403,
0x213703,
0x201d03,
0x3ac745,
0x2673c4,
0x268507,
0x2698c2,
0x26a803,
0x26ee86,
0x270683,
0x270a03,
0x28e3c3,
0x378803,
0x221943,
0x201c83,
0x2ad347,
0xea0f583,
0x240243,
0x20afc3,
0x211983,
0x231a43,
0x21cb03,
0x22b2c5,
0x388583,
0x24e349,
0x200c03,
0x31ac43,
0xee5b543,
0x22bd83,
0x203c83,
0x219608,
0x2bfb06,
0x3785c6,
0x2ca886,
0x271607,
0x2252c3,
0x2384c3,
0x214e43,
0x29e306,
0x20ffc2,
0x2f33c3,
0x344245,
0x214883,
0x32ad07,
0x1608c43,
0x2a1943,
0x241a83,
0x241503,
0x247043,
0x24acc3,
0x366386,
0x3bfdc6,
0x389a83,
0x3407c3,
0x205443,
0x21dcc3,
0x31d4c3,
0x310483,
0x314143,
0x212c85,
0x2423c3,
0x2423c6,
0x21bd03,
0x3c3688,
0x236883,
0x236889,
0x263988,
0x224888,
0x22e2c5,
0x23c04a,
0x23d60a,
0x24174b,
0x245088,
0x2ce083,
0x216ec3,
0x314183,
0x2edd03,
0x315888,
0x334d83,
0x3c8704,
0x205e02,
0x23fac3,
0x265603,
0x2007c3,
0x3af603,
0x283143,
0x23ae43,
0x22ccc2,
0x2233c3,
0x246143,
0x31fd43,
0x321d84,
0x260644,
0x2355c3,
0x1c3448,
0xe31e00c,
0xe6ea545,
0xdefc5,
0x2000c2,
0x200b02,
0x201902,
0x2029c2,
0x200202,
0x205202,
0x244b02,
0x201b42,
0x200382,
0x203f02,
0x215142,
0x20d3c2,
0x282182,
0x207002,
0x20ea82,
0x2035c2,
0x216402,
0x205442,
0x24bf42,
0x209982,
0x200682,
0x217ac2,
0x201a42,
0x206382,
0x201042,
0x230802,
0x2019c2,
0xc2,
0xb02,
0x1902,
0x29c2,
0x202,
0x5202,
0x44b02,
0x1b42,
0x382,
0x3f02,
0x15142,
0xd3c2,
0x82182,
0x7002,
0xea82,
0x35c2,
0x16402,
0x5442,
0x4bf42,
0x9982,
0x682,
0x17ac2,
0x1a42,
0x6382,
0x1042,
0x30802,
0x19c2,
0x21a043,
0x226783,
0x20f583,
0x214883,
0x24acc3,
0xf82,
0x21a043,
0x226783,
0x20f583,
0x214883,
0x24acc3,
0xa0789,
0xb642,
0x20b642,
0x24acc3,
0x10a1a043,
0x20f583,
0x1b1749,
0x214e43,
0xf5d07,
0x2445c2,
0x1c3448,
0x21a043,
0x226783,
0x20f583,
0x16e83,
0x214883,
0x24acc3,
0x79c2,
0x2001c2,
0x1427d45,
0x14f985,
0x213c82,
0x1c3448,
0xb642,
0x242882,
0x206442,
0x10210c,
0x20da42,
0x231a82,
0x218882,
0x1a4045,
0x200dc2,
0x201802,
0x217a02,
0x208e02,
0x2035c2,
0x24a242,
0x214942,
0x2b60c2,
0x11a7f604,
0x142,
0xf5d87,
0x15943,
0x1db18d,
0xfaf89,
0xf140b,
0xfdd48,
0x73ec9,
0x11b446,
0x20f583,
0x1c3448,
0x1bfd04,
0x2d03,
0x1bee85,
0x1c3448,
0x1ec6c7,
0x12c5ea87,
0x13269384,
0x6d446,
0x1beec9,
0xbea8e,
0x10210c,
0x146087,
0x15bc683,
0x13602142,
0x149f49,
0x1ed5c4,
0x2000c2,
0x265a04,
0x20b642,
0x21a043,
0x203142,
0x226783,
0x26dc3,
0x200382,
0x2eef84,
0x20bc83,
0x2593c2,
0x214883,
0x18882,
0x2003c2,
0x24acc3,
0x219086,
0x33d48f,
0x733483,
0x1c3448,
0x20b642,
0x204703,
0x20f583,
0x214e43,
0x14bdabc7,
0x14a7606,
0x1f3d06,
0xf2389,
0x14fcd6c8,
0x1e6304,
0x152cab0a,
0x163988,
0x15c16a87,
0xd9f88,
0xbea88,
0x15e86cb,
0x147fb0a,
0x16070943,
0x103189,
0x1650b188,
0x16b8e487,
0x1463d4a,
0x1507c07,
0xba74b,
0x16e8a2cc,
0x16bf05,
0xdc4c5,
0x123409,
0x1dbf44,
0x11d443,
0x156cac45,
0x12ee43,
0x15a35ac3,
0x12ee43,
0x15942,
0x21c2,
0xba42,
0xba42,
0x3d82,
0xba42,
0x3342,
0x45c2,
0x101c2,
0x14f985,
0xf5d87,
0x1e6304,
0x109484,
0x20b642,
0x21a043,
0x20f583,
0x214883,
0x2000c2,
0x209582,
0x20aa82,
0x17e1a043,
0x24a202,
0x226783,
0x200bc2,
0x203942,
0x20f583,
0x216e82,
0x261042,
0x22fcc2,
0x20ad02,
0x2a4fc2,
0x200802,
0x204142,
0x201742,
0x21dd82,
0x209bc2,
0x4484c,
0x2cd142,
0x283382,
0x22b242,
0x202582,
0x214e43,
0x201942,
0x214883,
0x20b482,
0x24fdc2,
0x24acc3,
0x24dac2,
0x206382,
0x2213c2,
0x200e02,
0x22c602,
0x215982,
0x209b02,
0x25c442,
0x22b282,
0x33060a,
0x375dca,
0x3a8f8a,
0x3f43c2,
0x2039c2,
0x22b982,
0x182fe909,
0x187d6f0a,
0x154be47,
0x18a00fc2,
0x1446b83,
0x2902,
0x1d6f0a,
0x16e3ce,
0x2346c4,
0x107245,
0x1921a043,
0x4b8c3,
0x226783,
0x2607c4,
0x20f583,
0x25c204,
0x20bc83,
0x145e89,
0x51fc6,
0x214e43,
0x100d44,
0x1443,
0x214883,
0x9bf05,
0x208c43,
0x24acc3,
0x1440704,
0x2423c3,
0x195547c4,
0xd2a48,
0x200f83,
0x1c3448,
0x6502,
0x1527143,
0x1333c6,
0x1577ec4,
0x4c85,
0x1dbd4a,
0x138682,
0x1a00578d,
0x1bdcc6,
0x152051,
0x1a6fe909,
0x15d4ca,
0x4d08,
0x167d48,
0x152e8e,
0x89e53,
0x210a78c7,
0x1d42,
0x148210,
0x152c8c,
0xfea94,
0x1b87c7,
0x24c0e,
0x14f98b,
0x1519cb,
0x1c740a,
0x133907,
0x1c3448,
0xb3d88,
0xf747,
0x21422bcb,
0x23e46,
0x26647,
0x3ac2,
0xef7cd,
0x13e705,
0x1d647,
0x133c4a,
0x1402cc,
0x14048f,
0xae74f,
0x16e3c2,
0xb642,
0x9a148,
0x21903e8c,
0x1b204a,
0x21f656ca,
0xf638a,
0x86cca,
0x8ffc8,
0x2d785,
0x728c8,
0xf6848,
0x1ec688,
0x153648,
0x101c2,
0xae4cf,
0x1427dcd,
0x6d8b,
0xd5448,
0x42b87,
0x5940a,
0x3e7cb,
0xa9cc9,
0x59307,
0xf8506,
0x2d688,
0x3d7cc,
0x1e9987,
0x244ca,
0xa3c8,
0x11780e,
0x12078e,
0x13374b,
0x16600b,
0x3828b,
0x3d309,
0x4318b,
0x4864d,
0x4b94b,
0x4ca4d,
0x4cdcd,
0x5a30a,
0x6048b,
0x56a0b,
0x5a045,
0x221cd710,
0x80392,
0x33011,
0x176752,
0x35f8f,
0x7f7cf,
0x15118d,
0x85250,
0xa842,
0x22620948,
0x1e9808,
0x64f50,
0x12c88e,
0x22b77a85,
0x5e68b,
0x144f90,
0xaaecb,
0x1bc3cc,
0x729ca,
0x1661c9,
0x735c8,
0x78887,
0x78bc7,
0x78d87,
0x79cc7,
0x7b747,
0x7bc07,
0x7c307,
0x7c747,
0x7d207,
0x7d587,
0x7da47,
0x7dc07,
0x7ddc7,
0x7df87,
0x7e307,
0x7e687,
0x7ff87,
0x80807,
0x812c7,
0x81587,
0x81747,
0x81a47,
0x82047,
0x82247,
0x82bc7,
0x82d87,
0x82f47,
0x83207,
0x83847,
0x83fc7,
0x86b07,
0x86f47,
0x87747,
0x87907,
0x87f47,
0x882c7,
0x88c87,
0x89087,
0x893c7,
0x89587,
0x899c7,
0x8a5c7,
0x8b707,
0x8bcc7,
0x8be87,
0x8c307,
0x8cc47,
0xef42,
0xf694a,
0x1b308,
0x1c41cc,
0x124c87,
0x58f85,
0x61591,
0x7286,
0x137bca,
0x99fca,
0x6d446,
0x3f78b,
0x642,
0x3c691,
0x131809,
0xab8c9,
0xace06,
0x1742,
0x70d0a,
0xbf0c9,
0xbf80f,
0xbfe0e,
0xc1bc8,
0x22f53092,
0x18208,
0x232737c7,
0xc468f,
0x7142,
0x178409,
0x10044a,
0x2361a389,
0xdaec9,
0xdaecc,
0x19a4b,
0x5824e,
0x11c0c,
0x102e8f,
0x1c980e,
0x50fcc,
0x64d49,
0x71a11,
0x88448,
0x92f12,
0x94d8d,
0x993cd,
0x9ee4b,
0x167f15,
0x191549,
0x1b6d0a,
0x1df109,
0xa27d0,
0xa914b,
0xb1c8f,
0xb928b,
0xc710c,
0xc77d0,
0xdfdca,
0xf884d,
0x12b38e,
0x19f6ca,
0xc8bcc,
0xcf7d4,
0x131491,
0x1c470b,
0xd82cf,
0xd930d,
0xda3ce,
0xddf0c,
0xde64c,
0xdfacb,
0xe1c0e,
0xe4490,
0xe534b,
0xf740d,
0x10fd8f,
0x10eacc,
0x11704e,
0x185451,
0x12ae8c,
0x169d07,
0x16bb8d,
0x17600c,
0x180f50,
0x19b74d,
0x19c3c7,
0x1a5c90,
0x1b3048,
0xc814b,
0xca18f,
0x1c4448,
0x57b8d,
0x119c50,
0x182fc9,
0x23bcd6c8,
0x23ece206,
0xcf503,
0x1ade89,
0xade49,
0xd4345,
0xaf02,
0x59889,
0x6de0a,
0x242933c6,
0x14933cd,
0x24706444,
0x1e4986,
0x28b4a,
0x2af0d,
0x24ae5b8b,
0x1e9e08,
0x24c65589,
0x24343,
0x17c7ca,
0xf53d1,
0xf5809,
0xf6307,
0xf7148,
0xf8b87,
0x736c8,
0xae5cb,
0x13b509,
0x101590,
0x101a4c,
0x101ec9,
0x10210c,
0x2530250d,
0x1037c8,
0x103cc5,
0x1d0fc8,
0x1a4f4a,
0x1b8ec7,
0x25c2,
0x25679555,
0x145c8a,
0x13e549,
0x1ef4c8,
0xae009,
0x9605,
0x12ab8a,
0x1a07,
0xa050f,
0x16bf8b,
0x1ec90c,
0x30712,
0xc0906,
0x1580588,
0x8e5c5,
0x11d688,
0x1e4acb,
0xe6ad1,
0x179d47,
0x6e40a,
0x18784c,
0x25b0b045,
0x1b72cc,
0x25d129ce,
0x142743,
0x19ec86,
0x4a242,
0x11468b,
0x11564a,
0x151640c,
0x1e9d08,
0x4cc08,
0x263ef546,
0x17ef87,
0x23f8e,
0x1534c7,
0x3b02,
0x2fc2,
0x188850,
0x77e47,
0x77f4f,
0x1b506,
0xa8b4e,
0xb424b,
0x5e0c8,
0xaa089,
0x150652,
0x11dccd,
0x11e848,
0xf12c9,
0x1a718d,
0xe889,
0x782cb,
0x7ae88,
0x7e488,
0x80f88,
0x81bc9,
0x81dca,
0x8254c,
0x2398a,
0xe094a,
0x11d507,
0x43a8a,
0xf90c8,
0x1d3e0d,
0x62ad1,
0x266da6c6,
0x16d20b,
0x3b48c,
0xff48,
0x1dc8c9,
0x16548d,
0x79f10,
0x150dcc,
0x15450d,
0x10384f,
0xba42,
0x1df30d,
0x3342,
0x96c2,
0x11d44a,
0x26bd0d0a,
0x32e4a,
0x26e8bfc8,
0x137aca,
0x12460b,
0x126c47,
0x1b41cc,
0x120a0c,
0x12940a,
0x2712968f,
0x129a4c,
0x129d47,
0x12b70e,
0x275f4285,
0x1eab88,
0x79c2,
0x1424dc3,
0x1aa0494e,
0x1b2029ce,
0x1bb2658a,
0x1c33718e,
0x1ca082ce,
0x1d353c8c,
0x154be47,
0x155d589,
0x1446b83,
0x1db5ce8c,
0x1e20a849,
0x1ebd7e09,
0x1f3dbb49,
0x2902,
0x4891,
0x2911,
0x1264cd,
0x1370d1,
0x1d4fd1,
0x153bcf,
0x15cdcf,
0x1cc20c,
0x1d7d4c,
0x1dba8c,
0xec7cd,
0xfd515,
0x13c14c,
0x13e80c,
0x179ed0,
0x1c5acc,
0x1c8a8c,
0x1d17d9,
0x1d9759,
0x8019,
0xa594,
0xf8d4,
0x107d4,
0x10d54,
0x1a994,
0x1fa0fb89,
0x20010a89,
0x20b3e8c9,
0x1ae88649,
0x2902,
0x1b688649,
0x2902,
0x800a,
0x2902,
0x1be88649,
0x2902,
0x800a,
0x2902,
0x1c688649,
0x2902,
0x1ce88649,
0x2902,
0x1d688649,
0x2902,
0x800a,
0x2902,
0x1de88649,
0x2902,
0x800a,
0x2902,
0x1e688649,
0x2902,
0x1ee88649,
0x2902,
0x800a,
0x2902,
0x1f688649,
0x2902,
0x800a,
0x2902,
0x1fe88649,
0x2902,
0x20688649,
0x2902,
0x20e88649,
0x2902,
0x800a,
0x2902,
0x1400401,
0x152045,
0x1c7404,
0x1412f43,
0x15f2603,
0x141d983,
0x94ec4,
0x13b848,
0x494e,
0x29ce,
0x9280e,
0x12658a,
0x13718e,
0x82ce,
0x153c8c,
0x15ce8c,
0xa849,
0x1d7e09,
0x1dbb49,
0xfb89,
0x10a89,
0x13e8c9,
0xfd70d,
0x11009,
0x1ac49,
0x150a84,
0x1720c4,
0x199884,
0x1cacc4,
0xbaa04,
0x1b9944,
0x1e6a84,
0x69004,
0x1b404,
0x642c4,
0x334c9,
0x334cc,
0x159186,
0x15918e,
0x94ec4,
0x159bf43,
0x7e87,
0x149440c,
0x4d03,
0x642c4,
0xa842,
0x51887,
0x103e88,
0x191dc8,
0x4fd44,
0x1cb8c6,
0x54d47,
0xe8b44,
0x11c0c6,
0x216c2,
0x2d81,
0x1d3a44,
0x89cc6,
0x22603,
0xa842,
0x4d03,
0xe0143,
0x30503,
0x14743,
0x117783,
0x30705,
0x83382,
0x151682,
0x1bf708,
0xfa807,
0x15743,
0x13b587,
0x101c2,
0xf2389,
0x2000c2,
0x20b642,
0x203142,
0x21b5c2,
0x200382,
0x2003c2,
0x202fc2,
0x21a043,
0x226783,
0x20f583,
0x231a43,
0x214883,
0x24acc3,
0x1c3448,
0x21a043,
0x226783,
0x214883,
0x24acc3,
0x13b83,
0x20f583,
0x5c204,
0x2000c2,
0x20bec3,
0x29a1a043,
0x3acb47,
0x20f583,
0x222043,
0x225a04,
0x214883,
0x24acc3,
0x228d8a,
0x219085,
0x205443,
0x249902,
0x1c3448,
0x29eea54a,
0xc01,
0x1c3448,
0xb642,
0x140242,
0x2a66530b,
0x2aa1c1c4,
0x106385,
0x1405985,
0x103e86,
0x2ae05985,
0x6a043,
0xa7343,
0x1bfd04,
0x2d03,
0x1bee85,
0x14f985,
0x1c3448,
0x26647,
0x1a043,
0x38d4d,
0x2b647207,
0xcc6,
0x2b953ac5,
0x1b7892,
0xd87,
0x2f38a,
0x2cf48,
0x2f287,
0x170aca,
0x1becc8,
0x7ac47,
0x15ef8f,
0x574c7,
0x68e06,
0x144f90,
0x148e0c6,
0x5058f,
0x1bc09,
0x1e4a04,
0x2bc00e4e,
0x51bc9,
0x7e0c6,
0xeb09,
0x119186,
0x9dc6,
0xc3acc,
0x3e9ca,
0xa9e47,
0x115f4a,
0x1249,
0x10514c,
0x2b74a,
0x5b00a,
0x1beec9,
0x1e4986,
0xa9f0a,
0x11edca,
0xb6b4a,
0x16f909,
0xf4dc8,
0xf5046,
0xfb54d,
0x10210c,
0x6700b,
0xd4905,
0x2c38a7cc,
0x146087,
0x1e3989,
0xdea07,
0xbe494,
0x11a04b,
0xd528a,
0x1504ca,
0xbc64d,
0x1524809,
0x11da8c,
0x11e64b,
0x16a157,
0x16ac95,
0x3983,
0x3983,
0x38286,
0x3983,
0x103e88,
0x15ee43,
0x53544,
0x1f184,
0x1f18c,
0x6a303,
0x14b6c07,
0xf79cd,
0xaa045,
0x151e183,
0x1536ac8,
0x67409,
0x1b1749,
0x30705,
0x1e4acb,
0x1c49cb,
0x150ed43,
0x150ed48,
0x152986,
0x145a4c7,
0xa2a47,
0x2d0a7789,
0x14746,
0xbec3,
0x1c3448,
0xb642,
0x607c4,
0x10210c,
0x31d03,
0x13a505,
0x21a043,
0x226783,
0x20f583,
0x214883,
0x24acc3,
0x205d83,
0x21a043,
0x226783,
0x204703,
0x20f583,
0x214e43,
0x214883,
0x24acc3,
0x319283,
0x200f83,
0x205d83,
0x265a04,
0x21a043,
0x226783,
0x20f583,
0x214883,
0x24acc3,
0x211b43,
0x212f03,
0x249902,
0x2e8a7885,
0x1437143,
0x21a043,
0x226783,
0x226dc3,
0x204703,
0x20f583,
0x25c204,
0x20de83,
0x2384c3,
0x214e43,
0x214883,
0x24acc3,
0x205443,
0x2f629e03,
0x30609,
0xb642,
0x3f3903,
0x3021a043,
0x226783,
0x259f43,
0x20f583,
0x224b03,
0x2384c3,
0x24acc3,
0x205fc3,
0x3c80c4,
0x1c3448,
0x30a1a043,
0x226783,
0x2c1c83,
0x20f583,
0x214e43,
0x225a04,
0x214883,
0x24acc3,
0x227603,
0x1c3448,
0x3121a043,
0x226783,
0x204703,
0x10210c,
0x208c43,
0x24acc3,
0x1c3448,
0x154be47,
0x20bec3,
0x21a043,
0x226783,
0x20f583,
0x25c204,
0x225a04,
0x214883,
0x24acc3,
0x14f985,
0xf5d87,
0xbe6cb,
0x32241546,
0xf5c04,
0xd4905,
0x1470708,
0x2facd,
0x1cd6c8,
0x32a407c5,
0x2af84,
0xb642,
0x18b43,
0x159085,
0x445c2,
0x35cc45,
0x1c3448,
0x343341cd,
0x3460510a,
0x3982,
0x20883,
0x10210c,
0x17290f,
0x1b5c2,
0x94ec4,
0x642c4,
0xb642,
0x2000c2,
0x20bec3,
0x21a043,
0x20f583,
0x25c204,
0x214e43,
0x225a04,
0x214883,
0x24acc3,
0x205443,
0x21a043,
0x226783,
0x214883,
0x24acc3,
0x12c85,
0x339e48,
0x265a04,
0x3d4506,
0x3d7c06,
0x1c3448,
0x320543,
0x23ab49,
0x318455,
0x11845f,
0x21a043,
0x9ebc7,
0x221b92,
0x18dc86,
0x190485,
0x729ca,
0x1661c9,
0x22194f,
0xf5207,
0x2eef84,
0x225105,
0x31aa10,
0x284ac7,
0x10210c,
0x208c43,
0x2a1948,
0x64146,
0x2937ca,
0x2311c4,
0x30ad83,
0x249902,
0x30614b,
0x1c3203,
0x226783,
0x20f583,
0x197184,
0x21a043,
0x226783,
0x20f583,
0x214e43,
0x214883,
0x24acc3,
0x310783,
0x20b642,
0x3cc83,
0x100b04,
0x214883,
0x24acc3,
0x36846ac5,
0x1dc686,
0x21a043,
0x226783,
0x20f583,
0x214e43,
0x24acc3,
0x21a043,
0x226783,
0x20f583,
0x222043,
0x222383,
0x24acc3,
0xbec3,
0x20b642,
0x21a043,
0x226783,
0x214883,
0x24acc3,
0x26c02,
0x2000c2,
0x21a043,
0x226783,
0x20f583,
0x214883,
0x24acc3,
0x5985,
0x6a0c9,
0x4d03,
0x265a04,
0x21a043,
0x226783,
0x230944,
0x214883,
0x24acc3,
0x1c3448,
0x21a043,
0x226783,
0x20f583,
0x214883,
0x24acc3,
0x13bf09,
0x11d44,
0x21a043,
0x101c2,
0x226783,
0x204703,
0x211983,
0x214e43,
0x214883,
0x24acc3,
0x19c2,
0x21a043,
0x226783,
0x20f583,
0x3b9544,
0x25c204,
0x214883,
0x24acc3,
0x200f83,
0x2742,
0x20b642,
0x21a043,
0x226783,
0x20f583,
0x214883,
0x24acc3,
0x161243,
0x1c3448,
0x21a043,
0x226783,
0x20f583,
0x37ee83,
0xf2c3,
0x22043,
0x214883,
0x24acc3,
0x3a086,
0x33060a,
0x34e149,
0x369a8b,
0x369eca,
0x375dca,
0x386bcb,
0x39b20a,
0x3a280a,
0x3a8f8a,
0x3a920b,
0x3ce989,
0x3de04a,
0x3de88b,
0x3ede8b,
0x3f2fca,
0x6282,
0x21a043,
0x226783,
0x204703,
0x214e43,
0x214883,
0x24acc3,
0x610b,
0x12c887,
0x73b48,
0x1a72c4,
0x1e6304,
0xa2388,
0xf9b06,
0xae706,
0x23b87,
0x12a947,
0x3589,
0x1c3448,
0x21a043,
0x727c4,
0x278884,
0x204e42,
0x225a04,
0x252f05,
0x205d83,
0x265a04,
0x21a043,
0x243544,
0x226783,
0x2607c4,
0x2eef84,
0x25c204,
0x2384c3,
0x214883,
0x24acc3,
0x2cf905,
0x211b43,
0x205443,
0x236d03,
0x223984,
0x333344,
0x246c85,
0x1c3448,
0x3ebc44,
0x209f46,
0x3bf004,
0x20b642,
0x230b07,
0x256387,
0x25d444,
0x2fa885,
0x39b945,
0x239805,
0x25c204,
0x2716c8,
0x2680c6,
0x32f248,
0x2f8245,
0x2fc3c5,
0x27a004,
0x24acc3,
0x30b844,
0x385bc6,
0x219183,
0x223984,
0x26ed05,
0x259804,
0x2b7944,
0x249902,
0x3a1ec6,
0x3c1786,
0x31be45,
0x2000c2,
0x20bec3,
0xf9c86,
0x3be0b642,
0x220ac4,
0x1981c4,
0x6f005,
0x200382,
0x214e43,
0x2736c2,
0x214883,
0x2003c2,
0x308746,
0x219303,
0x1e4905,
0x200f83,
0x1c3448,
0x1c3448,
0x20f583,
0x10210c,
0x2000c2,
0x3ca0b642,
0x20f583,
0x27dd43,
0x20de83,
0x21c1c4,
0x214883,
0x24acc3,
0x1c3448,
0xc0847,
0x2000c2,
0x3d20b642,
0x21a043,
0x214883,
0x24acc3,
0x682,
0x20ea02,
0x22ccc2,
0x222043,
0x305103,
0x2000c2,
0x14f985,
0x1c3448,
0xf5d87,
0x20b642,
0x226783,
0x2607c4,
0x207783,
0x20f583,
0x211983,
0x214e43,
0x214883,
0x21c243,
0x24acc3,
0x2190c3,
0xd2a48,
0xf83,
0x147593,
0x14b954,
0x14f985,
0xf5d87,
0x2f389,
0x11c806,
0x16f34b,
0x38286,
0x6bb47,
0x1bc006,
0x649,
0x16278a,
0x9e0cd,
0x1dae8c,
0x11f74a,
0xab348,
0x1a4045,
0x2f3c8,
0x1b506,
0x1d9206,
0x5f986,
0x20a842,
0x178884,
0xe0146,
0x14e754e,
0x5086,
0x7a60c,
0x3e6a760b,
0x14f985,
0x15278b,
0x3eb67b87,
0x3ef67b8a,
0x3f3d9144,
0x88c9,
0xfdc8,
0x1c75c7,
0x2de11,
0x130dca,
0x21a043,
0x3f694308,
0x170a45,
0x1a0e88,
0x36604,
0x6e005,
0xb8647,
0x3f9d6d46,
0xe044b,
0x3ffc7cc9,
0x181c5,
0x61586,
0x168e86,
0xa528a,
0xd184c,
0x1ca843,
0x1e6304,
0x403d2484,
0x67409,
0x113107,
0x10070a,
0x14ea449,
0x605,
0x120703,
0x406420c7,
0x9bf05,
0x1573546,
0x14638c6,
0x3f84c,
0x10d308,
0x40930fc5,
0x40c4a243,
0x113844,
0x1d78b,
0x14b0cb,
0x4125ac0c,
0x142d843,
0xd61c8,
0x1c49cb,
0xb8509,
0xd5603,
0x124908,
0x1428a86,
0x9e747,
0x41765489,
0x42af0c48,
0xbaf47,
0xdc4ca,
0x42f6a688,
0x11e30d,
0x1cc989,
0x112c8,
0x4d03,
0x1486089,
0x642c4,
0x187d45,
0x47143,
0x38286,
0x103e88,
0x6502,
0x1b404,
0xaa345,
0x1addc4,
0x1437dc3,
0x24dc7,
0x41a24dc3,
0x41fb8246,
0x42244e04,
0x42601b07,
0x103e84,
0x17ef87,
0x103e84,
0x17ef87,
0x103e84,
0x103e84,
0x17ef87,
0x5989,
0x41,
0x21a043,
0x226783,
0x20f583,
0x214e43,
0x214883,
0x24acc3,
0x2000c2,
0x20b642,
0x20f583,
0x206502,
0x214883,
0x24acc3,
0x219303,
0x38ef8f,
0x38f34e,
0x1c3448,
0x21a043,
0x52a87,
0x226783,
0x20f583,
0x20bc83,
0x214883,
0x24acc3,
0x4fc4,
0x2e44,
0xa04,
0x203a83,
0x203a87,
0x203f42,
0x27ee89,
0x200b02,
0x388b4b,
0x2b154a,
0x2b7d09,
0x200542,
0x2369c6,
0x25ed95,
0x388c95,
0x261ad3,
0x389213,
0x204302,
0x22bb45,
0x3ea8cc,
0x287c8b,
0x269e45,
0x2029c2,
0x314102,
0x377546,
0x201d42,
0x29ca06,
0x36640d,
0x3a3dcc,
0x3cd784,
0x200882,
0x214202,
0x2932c8,
0x200202,
0x202f06,
0x3a480f,
0x202f10,
0x2ff204,
0x25ef55,
0x261c53,
0x217143,
0x35c78a,
0x392b47,
0x398a89,
0x315cc7,
0x21da82,
0x200282,
0x3d2386,
0x20b102,
0x1c3448,
0x211f02,
0x202642,
0x2121c7,
0x398e07,
0x398e11,
0x225505,
0x22550e,
0x225fcf,
0x203ac2,
0x227547,
0x227708,
0x201002,
0x229b02,
0x2143c6,
0x2143cf,
0x27b1d0,
0x236f02,
0x203d82,
0x230c48,
0x203d83,
0x29b148,
0x247d4d,
0x2063c3,
0x3d7a48,
0x26c00f,
0x26c3ce,
0x35018a,
0x2f4111,
0x2f4590,
0x3b0b8d,
0x3b0ecc,
0x3f3787,
0x35c907,
0x3d45c9,
0x216f42,
0x205202,
0x26d8cc,
0x26dbcb,
0x2045c2,
0x2dfc86,
0x212f82,
0x200482,
0x36e3c2,
0x20b642,
0x239244,
0x246887,
0x203682,
0x24d507,
0x24f347,
0x215942,
0x218402,
0x252945,
0x203402,
0x2d0bce,
0x215b8d,
0x226783,
0x25880e,
0x231e8d,
0x34cc83,
0x2017c2,
0x2990c4,
0x211542,
0x22e042,
0x3add05,
0x3b3c47,
0x257682,
0x21b5c2,
0x25f487,
0x267788,
0x2698c2,
0x28e646,
0x26d74c,
0x26da8b,
0x205b02,
0x274b0f,
0x274ed0,
0x2752cf,
0x275695,
0x275bd4,
0x2760ce,
0x27644e,
0x2767cf,
0x276b8e,
0x276f14,
0x277413,
0x2778cd,
0x28ce09,
0x2a0083,
0x206582,
0x364805,
0x207786,
0x200382,
0x2e4f47,
0x20f583,
0x200642,
0x38bcc8,
0x2f4351,
0x2f4790,
0x204182,
0x29f347,
0x2040c2,
0x271107,
0x20af02,
0x254e89,
0x377507,
0x29f808,
0x3d6b86,
0x305003,
0x39e645,
0x20b602,
0x2004c2,
0x34cb85,
0x370845,
0x209a42,
0x237743,
0x352b07,
0x3d9487,
0x203c82,
0x39ac04,
0x20a243,
0x3f3b89,
0x20a248,
0x212a82,
0x20fe02,
0x22e807,
0x3584c5,
0x285788,
0x286547,
0x20ddc3,
0x2dffc6,
0x3b0a0d,
0x3b0d8c,
0x3a1086,
0x206442,
0x205942,
0x200ec2,
0x26be8f,
0x26c28e,
0x39b9c7,
0x2024c2,
0x214e45,
0x214e46,
0x22ab02,
0x201942,
0x2a0d06,
0x24fb03,
0x3d1206,
0x2e8b05,
0x2e8b0d,
0x2e9095,
0x2e990c,
0x2e9c8d,
0x2e9fd2,
0x20d3c2,
0x282182,
0x10210c,
0x202202,
0x379cc6,
0x211ac6,
0x4429eb44,
0x2025c2,
0x207806,
0x217a02,
0x254405,
0x203cc2,
0x215c89,
0x2161cc,
0x21650b,
0x2003c2,
0x268908,
0x201982,
0x207002,
0x287a46,
0x2885c5,
0x394447,
0x358845,
0x27a8c5,
0x204d82,
0x22f482,
0x2035c2,
0x2b1f87,
0x30880d,
0x308b8c,
0x2517c7,
0x28e5c2,
0x216402,
0x379688,
0x259a08,
0x327448,
0x3c4404,
0x2e1e87,
0x3064c3,
0x209ec2,
0x211b42,
0x309589,
0x317c07,
0x205442,
0x288085,
0x221e42,
0x223c42,
0x30f203,
0x30f206,
0x310482,
0x313702,
0x200402,
0x234586,
0x357f07,
0x21d602,
0x200902,
0x29af8f,
0x25864d,
0x2db38e,
0x231d0c,
0x20c802,
0x2026c2,
0x3d69c5,
0x32eb06,
0x201d82,
0x209982,
0x200682,
0x232004,
0x354204,
0x360a46,
0x202fc2,
0x29bdc7,
0x234683,
0x249088,
0x249a48,
0x250e47,
0x38e646,
0x201a82,
0x232603,
0x232607,
0x2875c6,
0x2d6385,
0x257ec8,
0x2075c2,
0x2fc8c7,
0x230802,
0x2a7382,
0x206342,
0x2030c9,
0x209202,
0x111908,
0x201682,
0x2b0b43,
0x336e87,
0x201b02,
0x21634c,
0x21664b,
0x3a1106,
0x30f905,
0x4462b803,
0x2021c2,
0x2019c2,
0x2d7cc6,
0x234b83,
0x3b92c7,
0x20ea42,
0x2008c2,
0x25ec15,
0x388e55,
0x261993,
0x389393,
0x279a47,
0x28b891,
0x295090,
0x29a312,
0x29d851,
0x2a1cc8,
0x2a1cd0,
0x2a5d0f,
0x2b1313,
0x2b7ad2,
0x2c3490,
0x376b8f,
0x39c552,
0x2c83d1,
0x2cb893,
0x2ce352,
0x2e874f,
0x2eb08e,
0x2efed2,
0x2f2f91,
0x2f384f,
0x2f6dce,
0x2f96d1,
0x2fbd50,
0x3047d2,
0x307e91,
0x30ca90,
0x30d4cf,
0x310811,
0x314290,
0x314d46,
0x327a47,
0x2284c7,
0x2027c2,
0x296485,
0x3e0bc7,
0x22ccc2,
0x205a42,
0x3d0f05,
0x20c703,
0x378306,
0x3089cd,
0x308d0c,
0x207882,
0x3ea74b,
0x287b4a,
0x28a70a,
0x22ba49,
0x2d6e8b,
0x30798d,
0x28668c,
0x31ae8a,
0x25018c,
0x25360b,
0x269c8c,
0x28414e,
0x28c48b,
0x2acb0c,
0x2ccf43,
0x37ef06,
0x36a682,
0x227e42,
0x26fd83,
0x201102,
0x220983,
0x2da0c6,
0x275847,
0x2dd0c6,
0x3b2208,
0x352988,
0x32cb46,
0x20b382,
0x31b80d,
0x31bb4c,
0x34b287,
0x31f587,
0x226402,
0x2216c2,
0x209142,
0x292602,
0x33f716,
0x344395,
0x347056,
0x34d093,
0x34d752,
0x35e9d3,
0x35f512,
0x3c048f,
0x3cfb98,
0x3d1e17,
0x3d5419,
0x3d7198,
0x3d8058,
0x3d8bd7,
0x3d9d97,
0x3dc056,
0x3e0713,
0x3e0d95,
0x3e17d2,
0x3e1c53,
0x16f02,
0x44a03584,