diff --git a/language/Makefile b/language/Makefile
deleted file mode 100644
index 79f0057..0000000
--- a/language/Makefile
+++ /dev/null
@@ -1,16 +0,0 @@
-# Copyright 2013 The Go Authors. All rights reserved.
-# Use of this source code is governed by a BSD-style
-# license that can be found in the LICENSE file.
-
-CLEANFILES+=maketables
-
-maketables: maketables.go
-	go build $^
-
-tables:	maketables
-	./maketables > tables.go
-	gofmt -w -s tables.go
-
-# Build (but do not run) maketables during testing,
-# just to make sure it still compiles.
-testshort: maketables
diff --git a/language/common.go b/language/common.go
deleted file mode 100644
index 9d86e18..0000000
--- a/language/common.go
+++ /dev/null
@@ -1,16 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package language
-
-// This file contains code common to the maketables.go and the package code.
-
-// langAliasType is the type of an alias in langAliasMap.
-type langAliasType int8
-
-const (
-	langDeprecated langAliasType = iota
-	langMacro
-	langLegacy
-
-	langAliasTypeUnknown langAliasType = -1
-)
diff --git a/language/coverage.go b/language/coverage.go
index 101fd23..3e7377d 100644
--- a/language/coverage.go
+++ b/language/coverage.go
@@ -7,6 +7,8 @@
 import (
 	"fmt"
 	"sort"
+
+	"golang.org/x/text/language/internal"
 )
 
 // The Coverage interface is used to define the level of coverage of an
@@ -44,9 +46,9 @@
 // consecutive range, it simply returns a slice of numbers in increasing order.
 // The "undefined" region is not returned.
 func (s allSubtags) Regions() []Region {
-	reg := make([]Region, numRegions)
+	reg := make([]Region, language.NumRegions)
 	for i := range reg {
-		reg[i] = Region{regionID(i + 1)}
+		reg[i] = Region{language.Region(i + 1)}
 	}
 	return reg
 }
@@ -55,9 +57,9 @@
 // consecutive range, it simply returns a slice of numbers in increasing order.
 // The "undefined" script is not returned.
 func (s allSubtags) Scripts() []Script {
-	scr := make([]Script, numScripts)
+	scr := make([]Script, language.NumScripts)
 	for i := range scr {
-		scr[i] = Script{scriptID(i + 1)}
+		scr[i] = Script{language.Script(i + 1)}
 	}
 	return scr
 }
@@ -65,22 +67,10 @@
 // BaseLanguages returns the list of all supported base languages. It generates
 // the list by traversing the internal structures.
 func (s allSubtags) BaseLanguages() []Base {
-	base := make([]Base, 0, numLanguages)
-	for i := 0; i < langNoIndexOffset; i++ {
-		// We included "und" already for the value 0.
-		if i != nonCanonicalUnd {
-			base = append(base, Base{langID(i)})
-		}
-	}
-	i := langNoIndexOffset
-	for _, v := range langNoIndex {
-		for k := 0; k < 8; k++ {
-			if v&1 == 1 {
-				base = append(base, Base{langID(i)})
-			}
-			v >>= 1
-			i++
-		}
+	bs := language.BaseLanguages()
+	base := make([]Base, len(bs))
+	for i, b := range bs {
+		base[i] = Base{b}
 	}
 	return base
 }
@@ -134,7 +124,7 @@
 		}
 		a := make([]Base, len(tags))
 		for i, t := range tags {
-			a[i] = Base{langID(t.lang)}
+			a[i] = Base{language.Language(t.tag.LangID)}
 		}
 		sort.Sort(bases(a))
 		k := 0
diff --git a/language/coverage_test.go b/language/coverage_test.go
index 8e08e5c..8d59673 100644
--- a/language/coverage_test.go
+++ b/language/coverage_test.go
@@ -8,6 +8,8 @@
 	"fmt"
 	"reflect"
 	"testing"
+
+	"golang.org/x/text/language/internal"
 )
 
 func TestSupported(t *testing.T) {
@@ -15,9 +17,9 @@
 	// results is identical to the number of results on record, that all results
 	// are distinct and that all results are valid.
 	tests := map[string]int{
-		"BaseLanguages": numLanguages,
-		"Scripts":       numScripts,
-		"Regions":       numRegions,
+		"BaseLanguages": language.NumLanguages,
+		"Scripts":       language.NumScripts,
+		"Regions":       language.NumRegions,
 		"Tags":          0,
 	}
 	sup := reflect.ValueOf(Supported)
diff --git a/language/gen.go b/language/gen.go
index 302f194..5a0b393 100644
--- a/language/gen.go
+++ b/language/gen.go
@@ -10,21 +10,17 @@
 package main
 
 import (
-	"bufio"
 	"flag"
 	"fmt"
 	"io"
-	"io/ioutil"
 	"log"
-	"math"
 	"reflect"
-	"regexp"
 	"sort"
 	"strconv"
 	"strings"
 
 	"golang.org/x/text/internal/gen"
-	"golang.org/x/text/internal/tag"
+	"golang.org/x/text/language/internal"
 	"golang.org/x/text/unicode/cldr"
 )
 
@@ -39,81 +35,6 @@
 
 var comment = []string{
 	`
-lang holds an alphabetically sorted list of ISO-639 language identifiers.
-All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
-For 2-byte language identifiers, the two successive bytes have the following meaning:
-    - if the first letter of the 2- and 3-letter ISO codes are the same:
-      the second and third letter of the 3-letter ISO code.
-    - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
-For 3-byte language identifiers the 4th byte is 0.`,
-	`
-langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
-in lookup tables. The language ids for these language codes are derived directly
-from the letters and are not consecutive.`,
-	`
-altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
-to 2-letter language codes that cannot be derived using the method described above.
-Each 3-letter code is followed by its 1-byte langID.`,
-	`
-altLangIndex is used to convert indexes in altLangISO3 to langIDs.`,
-	`
-langAliasMap maps langIDs to their suggested replacements.`,
-	`
-script is an alphabetically sorted list of ISO 15924 codes. The index
-of the script in the string, divided by 4, is the internal scriptID.`,
-	`
-isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
-for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
-the UN.M49 codes used for groups.)`,
-	`
-regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
-Each 2-letter codes is followed by two bytes with the following meaning:
-    - [A-Z}{2}: the first letter of the 2-letter code plus these two 
-                letters form the 3-letter ISO code.
-    - 0, n:     index into altRegionISO3.`,
-	`
-regionTypes defines the status of a region for various standards.`,
-	`
-m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
-codes indicating collections of regions.`,
-	`
-m49Index gives indexes into fromM49 based on the three most significant bits
-of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
-   fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
-for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
-The region code is stored in the 9 lsb of the indexed value.`,
-	`
-fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`,
-	`
-altRegionISO3 holds a list of 3-letter region codes that cannot be
-mapped to 2-letter codes using the default algorithm. This is a short list.`,
-	`
-altRegionIDs holds a list of regionIDs the positions of which match those
-of the 3-letter ISO codes in altRegionISO3.`,
-	`
-variantNumSpecialized is the number of specialized variants in variants.`,
-	`
-suppressScript is an index from langID to the dominant script for that language,
-if it exists.  If a script is given, it should be suppressed from the language tag.`,
-	`
-likelyLang is a lookup table, indexed by langID, for the most likely
-scripts and regions given incomplete information. If more entries exist for a
-given language, region and script are the index and size respectively
-of the list in likelyLangList.`,
-	`
-likelyLangList holds lists info associated with likelyLang.`,
-	`
-likelyRegion is a lookup table, indexed by regionID, for the most likely
-languages and scripts given incomplete information. If more entries exist
-for a given regionID, lang and script are the index and size respectively
-of the list in likelyRegionList.
-TODO: exclude containers and user-definable regions from the list.`,
-	`
-likelyRegionList holds lists info associated with likelyRegion.`,
-	`
-likelyScript is a lookup table, indexed by scriptID, for the most likely
-languages and regions given a script.`,
-	`
 matchLang holds pairs of langIDs of base languages that are typically
 mutually intelligible. Each pair is associated with a confidence and
 whether the intelligibility goes one or both ways.`,
@@ -135,284 +56,52 @@
 all groups that are reachable from the groups set in the respective entry.`,
 }
 
-// TODO: consider changing some of these structures to tries. This can reduce
-// memory, but may increase the need for memory allocations. This could be
-// mitigated if we can piggyback on language tags for common cases.
-
-func failOnError(e error) {
-	if e != nil {
-		log.Panic(e)
-	}
-}
-
-type setType int
-
-const (
-	Indexed setType = 1 + iota // all elements must be of same size
-	Linear
-)
-
-type stringSet struct {
-	s              []string
-	sorted, frozen bool
-
-	// We often need to update values after the creation of an index is completed.
-	// We include a convenience map for keeping track of this.
-	update map[string]string
-	typ    setType // used for checking.
-}
-
-func (ss *stringSet) clone() stringSet {
-	c := *ss
-	c.s = append([]string(nil), c.s...)
-	return c
-}
-
-func (ss *stringSet) setType(t setType) {
-	if ss.typ != t && ss.typ != 0 {
-		log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ)
-	}
-}
-
-// parse parses a whitespace-separated string and initializes ss with its
-// components.
-func (ss *stringSet) parse(s string) {
-	scan := bufio.NewScanner(strings.NewReader(s))
-	scan.Split(bufio.ScanWords)
-	for scan.Scan() {
-		ss.add(scan.Text())
-	}
-}
-
-func (ss *stringSet) assertChangeable() {
-	if ss.frozen {
-		log.Panic("attempt to modify a frozen stringSet")
-	}
-}
-
-func (ss *stringSet) add(s string) {
-	ss.assertChangeable()
-	ss.s = append(ss.s, s)
-	ss.sorted = ss.frozen
-}
-
-func (ss *stringSet) freeze() {
-	ss.compact()
-	ss.frozen = true
-}
-
-func (ss *stringSet) compact() {
-	if ss.sorted {
-		return
-	}
-	a := ss.s
-	sort.Strings(a)
-	k := 0
-	for i := 1; i < len(a); i++ {
-		if a[k] != a[i] {
-			a[k+1] = a[i]
-			k++
-		}
-	}
-	ss.s = a[:k+1]
-	ss.sorted = ss.frozen
-}
-
-type funcSorter struct {
-	fn func(a, b string) bool
-	sort.StringSlice
-}
-
-func (s funcSorter) Less(i, j int) bool {
-	return s.fn(s.StringSlice[i], s.StringSlice[j])
-}
-
-func (ss *stringSet) sortFunc(f func(a, b string) bool) {
-	ss.compact()
-	sort.Sort(funcSorter{f, sort.StringSlice(ss.s)})
-}
-
-func (ss *stringSet) remove(s string) {
-	ss.assertChangeable()
-	if i, ok := ss.find(s); ok {
-		copy(ss.s[i:], ss.s[i+1:])
-		ss.s = ss.s[:len(ss.s)-1]
-	}
-}
-
-func (ss *stringSet) replace(ol, nu string) {
-	ss.s[ss.index(ol)] = nu
-	ss.sorted = ss.frozen
-}
-
-func (ss *stringSet) index(s string) int {
-	ss.setType(Indexed)
-	i, ok := ss.find(s)
-	if !ok {
-		if i < len(ss.s) {
-			log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i])
-		}
-		log.Panicf("find: item %q is not in list", s)
-
-	}
-	return i
-}
-
-func (ss *stringSet) find(s string) (int, bool) {
-	ss.compact()
-	i := sort.SearchStrings(ss.s, s)
-	return i, i != len(ss.s) && ss.s[i] == s
-}
-
-func (ss *stringSet) slice() []string {
-	ss.compact()
-	return ss.s
-}
-
-func (ss *stringSet) updateLater(v, key string) {
-	if ss.update == nil {
-		ss.update = map[string]string{}
-	}
-	ss.update[v] = key
-}
-
-// join joins the string and ensures that all entries are of the same length.
-func (ss *stringSet) join() string {
-	ss.setType(Indexed)
-	n := len(ss.s[0])
-	for _, s := range ss.s {
-		if len(s) != n {
-			log.Panicf("join: not all entries are of the same length: %q", s)
-		}
-	}
-	ss.s = append(ss.s, strings.Repeat("\xff", n))
-	return strings.Join(ss.s, "")
-}
-
-// ianaEntry holds information for an entry in the IANA Language Subtag Repository.
-// All types use the same entry.
-// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various
-// fields.
-type ianaEntry struct {
-	typ            string
-	description    []string
-	scope          string
-	added          string
-	preferred      string
-	deprecated     string
-	suppressScript string
-	macro          string
-	prefix         []string
-}
-
 type builder struct {
 	w    *gen.CodeWriter
 	hw   io.Writer // MultiWriter for w and w.Hash
 	data *cldr.CLDR
 	supp *cldr.SupplementalData
 
-	// indices
-	locale      stringSet // common locales
-	lang        stringSet // canonical language ids (2 or 3 letter ISO codes) with data
-	langNoIndex stringSet // 3-letter ISO codes with no associated data
-	script      stringSet // 4-letter ISO codes
-	region      stringSet // 2-letter ISO or 3-digit UN M49 codes
-	variant     stringSet // 4-8-alphanumeric variant code.
-
-	// Region codes that are groups with their corresponding group IDs.
-	groups map[int]index
-
-	// langInfo
-	registry map[string]*ianaEntry
+	// lang   index
+	region index
+	script index
 }
 
-type index uint
+func (b *builder) langIndex(s string) uint16 {
+	return uint16(language.MustParseBase(s))
+}
+
+type index func(s string) int
+
+func (i index) index(s string) int {
+	return i(s)
+}
 
 func newBuilder(w *gen.CodeWriter) *builder {
 	r := gen.OpenCLDRCoreZip()
 	defer r.Close()
 	d := &cldr.Decoder{}
 	data, err := d.DecodeZip(r)
-	failOnError(err)
+	if err != nil {
+		log.Fatal(err)
+	}
 	b := builder{
 		w:    w,
 		hw:   io.MultiWriter(w, w.Hash),
 		data: data,
 		supp: data.Supplemental(),
+
+		script: func(s string) int {
+			return int(language.MustParseScript(s))
+		},
+
+		region: func(s string) int {
+			return int(language.MustParseRegion(s))
+		},
 	}
-	b.parseRegistry()
 	return &b
 }
 
-func (b *builder) parseRegistry() {
-	r := gen.OpenIANAFile("assignments/language-subtag-registry")
-	defer r.Close()
-	b.registry = make(map[string]*ianaEntry)
-
-	scan := bufio.NewScanner(r)
-	scan.Split(bufio.ScanWords)
-	var record *ianaEntry
-	for more := scan.Scan(); more; {
-		key := scan.Text()
-		more = scan.Scan()
-		value := scan.Text()
-		switch key {
-		case "Type:":
-			record = &ianaEntry{typ: value}
-		case "Subtag:", "Tag:":
-			if s := strings.SplitN(value, "..", 2); len(s) > 1 {
-				for a := s[0]; a <= s[1]; a = inc(a) {
-					b.addToRegistry(a, record)
-				}
-			} else {
-				b.addToRegistry(value, record)
-			}
-		case "Suppress-Script:":
-			record.suppressScript = value
-		case "Added:":
-			record.added = value
-		case "Deprecated:":
-			record.deprecated = value
-		case "Macrolanguage:":
-			record.macro = value
-		case "Preferred-Value:":
-			record.preferred = value
-		case "Prefix:":
-			record.prefix = append(record.prefix, value)
-		case "Scope:":
-			record.scope = value
-		case "Description:":
-			buf := []byte(value)
-			for more = scan.Scan(); more; more = scan.Scan() {
-				b := scan.Bytes()
-				if b[0] == '%' || b[len(b)-1] == ':' {
-					break
-				}
-				buf = append(buf, ' ')
-				buf = append(buf, b...)
-			}
-			record.description = append(record.description, string(buf))
-			continue
-		default:
-			continue
-		}
-		more = scan.Scan()
-	}
-	if scan.Err() != nil {
-		log.Panic(scan.Err())
-	}
-}
-
-func (b *builder) addToRegistry(key string, entry *ianaEntry) {
-	if info, ok := b.registry[key]; ok {
-		if info.typ != "language" || entry.typ != "extlang" {
-			log.Fatalf("parseRegistry: tag %q already exists", key)
-		}
-	} else {
-		b.registry[key] = entry
-	}
-}
-
 var commentIndex = make(map[string]string)
 
 func init() {
@@ -481,229 +170,8 @@
 	b.p()
 }
 
-type fromTo struct {
-	from, to uint16
-}
-
-func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) {
-	ss.sortFunc(func(a, b string) bool {
-		return index(a) < index(b)
-	})
-	m := []fromTo{}
-	for _, s := range ss.s {
-		m = append(m, fromTo{index(s), index(ss.update[s])})
-	}
-	b.writeSlice(name, m)
-}
-
-const base = 'z' - 'a' + 1
-
-func strToInt(s string) uint {
-	v := uint(0)
-	for i := 0; i < len(s); i++ {
-		v *= base
-		v += uint(s[i] - 'a')
-	}
-	return v
-}
-
-// converts the given integer to the original ASCII string passed to strToInt.
-// len(s) must match the number of characters obtained.
-func intToStr(v uint, s []byte) {
-	for i := len(s) - 1; i >= 0; i-- {
-		s[i] = byte(v%base) + 'a'
-		v /= base
-	}
-}
-
-func (b *builder) writeBitVector(name string, ss []string) {
-	vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8)))
-	for _, s := range ss {
-		v := strToInt(s)
-		vec[v/8] |= 1 << (v % 8)
-	}
-	b.writeSlice(name, vec)
-}
-
-// TODO: convert this type into a list or two-stage trie.
-func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) {
-	b.comment(name)
-	v := reflect.ValueOf(m)
-	sz := v.Len() * (2 + int(v.Type().Key().Size()))
-	for _, k := range m {
-		sz += len(k)
-	}
-	b.addSize(sz)
-	keys := []string{}
-	b.pf(`var %s = map[string]uint16{`, name)
-	for k := range m {
-		keys = append(keys, k)
-	}
-	sort.Strings(keys)
-	for _, k := range keys {
-		b.pf("\t%q: %v,", k, f(m[k]))
-	}
-	b.p("}")
-}
-
-func (b *builder) writeMap(name string, m interface{}) {
-	b.comment(name)
-	v := reflect.ValueOf(m)
-	sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size()))
-	b.addSize(sz)
-	f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool {
-		return strings.IndexRune("{}, ", r) != -1
-	})
-	sort.Strings(f[1:])
-	b.pf(`var %s = %s{`, name, f[0])
-	for _, kv := range f[1:] {
-		b.pf("\t%s,", kv)
-	}
-	b.p("}")
-}
-
-func (b *builder) langIndex(s string) uint16 {
-	if s == "und" {
-		return 0
-	}
-	if i, ok := b.lang.find(s); ok {
-		return uint16(i)
-	}
-	return uint16(strToInt(s)) + uint16(len(b.lang.s))
-}
-
-// inc advances the string to its lexicographical successor.
-func inc(s string) string {
-	const maxTagLength = 4
-	var buf [maxTagLength]byte
-	intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)])
-	for i := 0; i < len(s); i++ {
-		if s[i] <= 'Z' {
-			buf[i] -= 'a' - 'A'
-		}
-	}
-	return string(buf[:len(s)])
-}
-
-func (b *builder) parseIndices() {
-	meta := b.supp.Metadata
-
-	for k, v := range b.registry {
-		var ss *stringSet
-		switch v.typ {
-		case "language":
-			if len(k) == 2 || v.suppressScript != "" || v.scope == "special" {
-				b.lang.add(k)
-				continue
-			} else {
-				ss = &b.langNoIndex
-			}
-		case "region":
-			ss = &b.region
-		case "script":
-			ss = &b.script
-		case "variant":
-			ss = &b.variant
-		default:
-			continue
-		}
-		ss.add(k)
-	}
-	// Include any language for which there is data.
-	for _, lang := range b.data.Locales() {
-		if x := b.data.RawLDML(lang); false ||
-			x.LocaleDisplayNames != nil ||
-			x.Characters != nil ||
-			x.Delimiters != nil ||
-			x.Measurement != nil ||
-			x.Dates != nil ||
-			x.Numbers != nil ||
-			x.Units != nil ||
-			x.ListPatterns != nil ||
-			x.Collations != nil ||
-			x.Segmentations != nil ||
-			x.Rbnf != nil ||
-			x.Annotations != nil ||
-			x.Metadata != nil {
-
-			from := strings.Split(lang, "_")
-			if lang := from[0]; lang != "root" {
-				b.lang.add(lang)
-			}
-		}
-	}
-	// Include locales for plural rules, which uses a different structure.
-	for _, plurals := range b.data.Supplemental().Plurals {
-		for _, rules := range plurals.PluralRules {
-			for _, lang := range strings.Split(rules.Locales, " ") {
-				if lang = strings.Split(lang, "_")[0]; lang != "root" {
-					b.lang.add(lang)
-				}
-			}
-		}
-	}
-	// Include languages in likely subtags.
-	for _, m := range b.supp.LikelySubtags.LikelySubtag {
-		from := strings.Split(m.From, "_")
-		b.lang.add(from[0])
-	}
-	// Include ISO-639 alpha-3 bibliographic entries.
-	for _, a := range meta.Alias.LanguageAlias {
-		if a.Reason == "bibliographic" {
-			b.langNoIndex.add(a.Type)
-		}
-	}
-	// Include regions in territoryAlias (not all are in the IANA registry!)
-	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
-		if len(reg.Type) == 2 {
-			b.region.add(reg.Type)
-		}
-	}
-
-	for _, s := range b.lang.s {
-		if len(s) == 3 {
-			b.langNoIndex.remove(s)
-		}
-	}
-	b.writeConst("numLanguages", len(b.lang.slice())+len(b.langNoIndex.slice()))
-	b.writeConst("numScripts", len(b.script.slice()))
-	b.writeConst("numRegions", len(b.region.slice()))
-
-	// Add dummy codes at the start of each list to represent "unspecified".
-	b.lang.add("---")
-	b.script.add("----")
-	b.region.add("---")
-
-	// common locales
-	b.locale.parse(meta.DefaultContent.Locales)
-}
-
 // TODO: region inclusion data will probably not be use used in future matchers.
 
-func (b *builder) computeRegionGroups() {
-	b.groups = make(map[int]index)
-
-	// Create group indices.
-	for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID.
-		b.groups[i] = index(len(b.groups))
-	}
-	for _, g := range b.supp.TerritoryContainment.Group {
-		// Skip UN and EURO zone as they are flattening the containment
-		// relationship.
-		if g.Type == "EZ" || g.Type == "UN" {
-			continue
-		}
-		group := b.region.index(g.Type)
-		if _, ok := b.groups[group]; !ok {
-			b.groups[group] = index(len(b.groups))
-		}
-	}
-	if len(b.groups) > 64 {
-		log.Fatalf("only 64 groups supported, found %d", len(b.groups))
-	}
-	b.writeConst("nRegionGroups", len(b.groups))
-}
-
 var langConsts = []string{
 	"af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es",
 	"et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is",
@@ -717,648 +185,20 @@
 	"nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn",
 }
 
-// writeLanguage generates all tables needed for language canonicalization.
-func (b *builder) writeLanguage() {
-	meta := b.supp.Metadata
-
-	b.writeConst("nonCanonicalUnd", b.lang.index("und"))
-	b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
-	b.writeConst("langPrivateStart", b.langIndex("qaa"))
-	b.writeConst("langPrivateEnd", b.langIndex("qtz"))
-
-	// Get language codes that need to be mapped (overlong 3-letter codes,
-	// deprecated 2-letter codes, legacy and grandfathered tags.)
-	langAliasMap := stringSet{}
-	aliasTypeMap := map[string]langAliasType{}
-
-	// altLangISO3 get the alternative ISO3 names that need to be mapped.
-	altLangISO3 := stringSet{}
-	// Add dummy start to avoid the use of index 0.
-	altLangISO3.add("---")
-	altLangISO3.updateLater("---", "aa")
-
-	lang := b.lang.clone()
-	for _, a := range meta.Alias.LanguageAlias {
-		if a.Replacement == "" {
-			a.Replacement = "und"
-		}
-		// TODO: support mapping to tags
-		repl := strings.SplitN(a.Replacement, "_", 2)[0]
-		if a.Reason == "overlong" {
-			if len(a.Replacement) == 2 && len(a.Type) == 3 {
-				lang.updateLater(a.Replacement, a.Type)
-			}
-		} else if len(a.Type) <= 3 {
-			switch a.Reason {
-			case "macrolanguage":
-				aliasTypeMap[a.Type] = langMacro
-			case "deprecated":
-				// handled elsewhere
-				continue
-			case "bibliographic", "legacy":
-				if a.Type == "no" {
-					continue
-				}
-				aliasTypeMap[a.Type] = langLegacy
-			default:
-				log.Fatalf("new %s alias: %s", a.Reason, a.Type)
-			}
-			langAliasMap.add(a.Type)
-			langAliasMap.updateLater(a.Type, repl)
-		}
-	}
-	// Manually add the mapping of "nb" (Norwegian) to its macro language.
-	// This can be removed if CLDR adopts this change.
-	langAliasMap.add("nb")
-	langAliasMap.updateLater("nb", "no")
-	aliasTypeMap["nb"] = langMacro
-
-	for k, v := range b.registry {
-		// Also add deprecated values for 3-letter ISO codes, which CLDR omits.
-		if v.typ == "language" && v.deprecated != "" && v.preferred != "" {
-			langAliasMap.add(k)
-			langAliasMap.updateLater(k, v.preferred)
-			aliasTypeMap[k] = langDeprecated
-		}
-	}
-	// Fix CLDR mappings.
-	lang.updateLater("tl", "tgl")
-	lang.updateLater("sh", "hbs")
-	lang.updateLater("mo", "mol")
-	lang.updateLater("no", "nor")
-	lang.updateLater("tw", "twi")
-	lang.updateLater("nb", "nob")
-	lang.updateLater("ak", "aka")
-	lang.updateLater("bh", "bih")
-
-	// Ensure that each 2-letter code is matched with a 3-letter code.
-	for _, v := range lang.s[1:] {
-		s, ok := lang.update[v]
-		if !ok {
-			if s, ok = lang.update[langAliasMap.update[v]]; !ok {
-				continue
-			}
-			lang.update[v] = s
-		}
-		if v[0] != s[0] {
-			altLangISO3.add(s)
-			altLangISO3.updateLater(s, v)
-		}
-	}
-
-	// Complete canonicalized language tags.
-	lang.freeze()
-	for i, v := range lang.s {
-		// We can avoid these manual entries by using the IANA registry directly.
-		// Seems easier to update the list manually, as changes are rare.
-		// The panic in this loop will trigger if we miss an entry.
-		add := ""
-		if s, ok := lang.update[v]; ok {
-			if s[0] == v[0] {
-				add = s[1:]
-			} else {
-				add = string([]byte{0, byte(altLangISO3.index(s))})
-			}
-		} else if len(v) == 3 {
-			add = "\x00"
-		} else {
-			log.Panicf("no data for long form of %q", v)
-		}
-		lang.s[i] += add
-	}
-	b.writeConst("lang", tag.Index(lang.join()))
-
-	b.writeConst("langNoIndexOffset", len(b.lang.s))
-
-	// space of all valid 3-letter language identifiers.
-	b.writeBitVector("langNoIndex", b.langNoIndex.slice())
-
-	altLangIndex := []uint16{}
-	for i, s := range altLangISO3.slice() {
-		altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))})
-		if i > 0 {
-			idx := b.lang.index(altLangISO3.update[s])
-			altLangIndex = append(altLangIndex, uint16(idx))
-		}
-	}
-	b.writeConst("altLangISO3", tag.Index(altLangISO3.join()))
-	b.writeSlice("altLangIndex", altLangIndex)
-
-	b.writeSortedMap("langAliasMap", &langAliasMap, b.langIndex)
-	types := make([]langAliasType, len(langAliasMap.s))
-	for i, s := range langAliasMap.s {
-		types[i] = aliasTypeMap[s]
-	}
-	b.writeSlice("langAliasTypes", types)
-}
-
 var scriptConsts = []string{
 	"Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy",
 	"Zzzz",
 }
 
-func (b *builder) writeScript() {
-	b.writeConsts(b.script.index, scriptConsts...)
-	b.writeConst("script", tag.Index(b.script.join()))
-
-	supp := make([]uint8, len(b.lang.slice()))
-	for i, v := range b.lang.slice()[1:] {
-		if sc := b.registry[v].suppressScript; sc != "" {
-			supp[i+1] = uint8(b.script.index(sc))
-		}
-	}
-	b.writeSlice("suppressScript", supp)
-
-	// There is only one deprecated script in CLDR. This value is hard-coded.
-	// We check here if the code must be updated.
-	for _, a := range b.supp.Metadata.Alias.ScriptAlias {
-		if a.Type != "Qaai" {
-			log.Panicf("unexpected deprecated stript %q", a.Type)
-		}
-	}
-}
-
-func parseM49(s string) int16 {
-	if len(s) == 0 {
-		return 0
-	}
-	v, err := strconv.ParseUint(s, 10, 10)
-	failOnError(err)
-	return int16(v)
-}
-
 var regionConsts = []string{
 	"001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US",
 	"ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo.
 }
 
-func (b *builder) writeRegion() {
-	b.writeConsts(b.region.index, regionConsts...)
-
-	isoOffset := b.region.index("AA")
-	m49map := make([]int16, len(b.region.slice()))
-	fromM49map := make(map[int16]int)
-	altRegionISO3 := ""
-	altRegionIDs := []uint16{}
-
-	b.writeConst("isoRegionOffset", isoOffset)
-
-	// 2-letter region lookup and mapping to numeric codes.
-	regionISO := b.region.clone()
-	regionISO.s = regionISO.s[isoOffset:]
-	regionISO.sorted = false
-
-	regionTypes := make([]byte, len(b.region.s))
-
-	// Is the region valid BCP 47?
-	for s, e := range b.registry {
-		if len(s) == 2 && s == strings.ToUpper(s) {
-			i := b.region.index(s)
-			for _, d := range e.description {
-				if strings.Contains(d, "Private use") {
-					regionTypes[i] = iso3166UserAssigned
-				}
-			}
-			regionTypes[i] |= bcp47Region
-		}
-	}
-
-	// Is the region a valid ccTLD?
-	r := gen.OpenIANAFile("domains/root/db")
-	defer r.Close()
-
-	buf, err := ioutil.ReadAll(r)
-	failOnError(err)
-	re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`)
-	for _, m := range re.FindAllSubmatch(buf, -1) {
-		i := b.region.index(strings.ToUpper(string(m[1])))
-		regionTypes[i] |= ccTLD
-	}
-
-	b.writeSlice("regionTypes", regionTypes)
-
-	iso3Set := make(map[string]int)
-	update := func(iso2, iso3 string) {
-		i := regionISO.index(iso2)
-		if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] {
-			regionISO.s[i] += iso3[1:]
-			iso3Set[iso3] = -1
-		} else {
-			if ok && j >= 0 {
-				regionISO.s[i] += string([]byte{0, byte(j)})
-			} else {
-				iso3Set[iso3] = len(altRegionISO3)
-				regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))})
-				altRegionISO3 += iso3
-				altRegionIDs = append(altRegionIDs, uint16(isoOffset+i))
-			}
-		}
-	}
-	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
-		i := regionISO.index(tc.Type) + isoOffset
-		if d := m49map[i]; d != 0 {
-			log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d)
-		}
-		m49 := parseM49(tc.Numeric)
-		m49map[i] = m49
-		if r := fromM49map[m49]; r == 0 {
-			fromM49map[m49] = i
-		} else if r != i {
-			dep := b.registry[regionISO.s[r-isoOffset]].deprecated
-			if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) {
-				fromM49map[m49] = i
-			}
-		}
-	}
-	for _, ta := range b.supp.Metadata.Alias.TerritoryAlias {
-		if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 {
-			from := parseM49(ta.Type)
-			if r := fromM49map[from]; r == 0 {
-				fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset
-			}
-		}
-	}
-	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
-		if len(tc.Alpha3) == 3 {
-			update(tc.Type, tc.Alpha3)
-		}
-	}
-	// This entries are not included in territoryCodes. Mostly 3-letter variants
-	// of deleted codes and an entry for QU.
-	for _, m := range []struct{ iso2, iso3 string }{
-		{"CT", "CTE"},
-		{"DY", "DHY"},
-		{"HV", "HVO"},
-		{"JT", "JTN"},
-		{"MI", "MID"},
-		{"NH", "NHB"},
-		{"NQ", "ATN"},
-		{"PC", "PCI"},
-		{"PU", "PUS"},
-		{"PZ", "PCZ"},
-		{"RH", "RHO"},
-		{"VD", "VDR"},
-		{"WK", "WAK"},
-		// These three-letter codes are used for others as well.
-		{"FQ", "ATF"},
-	} {
-		update(m.iso2, m.iso3)
-	}
-	for i, s := range regionISO.s {
-		if len(s) != 4 {
-			regionISO.s[i] = s + "  "
-		}
-	}
-	b.writeConst("regionISO", tag.Index(regionISO.join()))
-	b.writeConst("altRegionISO3", altRegionISO3)
-	b.writeSlice("altRegionIDs", altRegionIDs)
-
-	// Create list of deprecated regions.
-	// TODO: consider inserting SF -> FI. Not included by CLDR, but is the only
-	// Transitionally-reserved mapping not included.
-	regionOldMap := stringSet{}
-	// Include regions in territoryAlias (not all are in the IANA registry!)
-	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
-		if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 {
-			regionOldMap.add(reg.Type)
-			regionOldMap.updateLater(reg.Type, reg.Replacement)
-			i, _ := regionISO.find(reg.Type)
-			j, _ := regionISO.find(reg.Replacement)
-			if k := m49map[i+isoOffset]; k == 0 {
-				m49map[i+isoOffset] = m49map[j+isoOffset]
-			}
-		}
-	}
-	b.writeSortedMap("regionOldMap", &regionOldMap, func(s string) uint16 {
-		return uint16(b.region.index(s))
-	})
-	// 3-digit region lookup, groupings.
-	for i := 1; i < isoOffset; i++ {
-		m := parseM49(b.region.s[i])
-		m49map[i] = m
-		fromM49map[m] = i
-	}
-	b.writeSlice("m49", m49map)
-
-	const (
-		searchBits = 7
-		regionBits = 9
-	)
-	if len(m49map) >= 1<<regionBits {
-		log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits)
-	}
-	m49Index := [9]int16{}
-	fromM49 := []uint16{}
-	m49 := []int{}
-	for k, _ := range fromM49map {
-		m49 = append(m49, int(k))
-	}
-	sort.Ints(m49)
-	for _, k := range m49[1:] {
-		val := (k & (1<<searchBits - 1)) << regionBits
-		fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)]))
-		m49Index[1:][k>>searchBits] = int16(len(fromM49))
-	}
-	b.writeSlice("m49Index", m49Index)
-	b.writeSlice("fromM49", fromM49)
-}
-
-const (
-	// TODO: put these lists in regionTypes as user data? Could be used for
-	// various optimizations and refinements and could be exposed in the API.
-	iso3166Except = "AC CP DG EA EU FX IC SU TA UK"
-	iso3166Trans  = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions.
-	// DY and RH are actually not deleted, but indeterminately reserved.
-	iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD"
-)
-
-const (
-	iso3166UserAssigned = 1 << iota
-	ccTLD
-	bcp47Region
-)
-
-func find(list []string, s string) int {
-	for i, t := range list {
-		if t == s {
-			return i
-		}
-	}
-	return -1
-}
-
-// writeVariants generates per-variant information and creates a map from variant
-// name to index value. We assign index values such that sorting multiple
-// variants by index value will result in the correct order.
-// There are two types of variants: specialized and general. Specialized variants
-// are only applicable to certain language or language-script pairs. Generalized
-// variants apply to any language. Generalized variants always sort after
-// specialized variants.  We will therefore always assign a higher index value
-// to a generalized variant than any other variant. Generalized variants are
-// sorted alphabetically among themselves.
-// Specialized variants may also sort after other specialized variants. Such
-// variants will be ordered after any of the variants they may follow.
-// We assume that if a variant x is followed by a variant y, then for any prefix
-// p of x, p-x is a prefix of y. This allows us to order tags based on the
-// maximum of the length of any of its prefixes.
-// TODO: it is possible to define a set of Prefix values on variants such that
-// a total order cannot be defined to the point that this algorithm breaks.
-// In other words, we cannot guarantee the same order of variants for the
-// future using the same algorithm or for non-compliant combinations of
-// variants. For this reason, consider using simple alphabetic sorting
-// of variants and ignore Prefix restrictions altogether.
-func (b *builder) writeVariant() {
-	generalized := stringSet{}
-	specialized := stringSet{}
-	specializedExtend := stringSet{}
-	// Collate the variants by type and check assumptions.
-	for _, v := range b.variant.slice() {
-		e := b.registry[v]
-		if len(e.prefix) == 0 {
-			generalized.add(v)
-			continue
-		}
-		c := strings.Split(e.prefix[0], "-")
-		hasScriptOrRegion := false
-		if len(c) > 1 {
-			_, hasScriptOrRegion = b.script.find(c[1])
-			if !hasScriptOrRegion {
-				_, hasScriptOrRegion = b.region.find(c[1])
-
-			}
-		}
-		if len(c) == 1 || len(c) == 2 && hasScriptOrRegion {
-			// Variant is preceded by a language.
-			specialized.add(v)
-			continue
-		}
-		// Variant is preceded by another variant.
-		specializedExtend.add(v)
-		prefix := c[0] + "-"
-		if hasScriptOrRegion {
-			prefix += c[1]
-		}
-		for _, p := range e.prefix {
-			// Verify that the prefix minus the last element is a prefix of the
-			// predecessor element.
-			i := strings.LastIndex(p, "-")
-			pred := b.registry[p[i+1:]]
-			if find(pred.prefix, p[:i]) < 0 {
-				log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v)
-			}
-			// The sorting used below does not work in the general case. It works
-			// if we assume that variants that may be followed by others only have
-			// prefixes of the same length. Verify this.
-			count := strings.Count(p[:i], "-")
-			for _, q := range pred.prefix {
-				if c := strings.Count(q, "-"); c != count {
-					log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count)
-				}
-			}
-			if !strings.HasPrefix(p, prefix) {
-				log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix)
-			}
-		}
-	}
-
-	// Sort extended variants.
-	a := specializedExtend.s
-	less := func(v, w string) bool {
-		// Sort by the maximum number of elements.
-		maxCount := func(s string) (max int) {
-			for _, p := range b.registry[s].prefix {
-				if c := strings.Count(p, "-"); c > max {
-					max = c
-				}
-			}
-			return
-		}
-		if cv, cw := maxCount(v), maxCount(w); cv != cw {
-			return cv < cw
-		}
-		// Sort by name as tie breaker.
-		return v < w
-	}
-	sort.Sort(funcSorter{less, sort.StringSlice(a)})
-	specializedExtend.frozen = true
-
-	// Create index from variant name to index.
-	variantIndex := make(map[string]uint8)
-	add := func(s []string) {
-		for _, v := range s {
-			variantIndex[v] = uint8(len(variantIndex))
-		}
-	}
-	add(specialized.slice())
-	add(specializedExtend.s)
-	numSpecialized := len(variantIndex)
-	add(generalized.slice())
-	if n := len(variantIndex); n > 255 {
-		log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n)
-	}
-	b.writeMap("variantIndex", variantIndex)
-	b.writeConst("variantNumSpecialized", numSpecialized)
-}
-
-func (b *builder) writeLanguageInfo() {
-}
-
-// writeLikelyData writes tables that are used both for finding parent relations and for
-// language matching.  Each entry contains additional bits to indicate the status of the
-// data to know when it cannot be used for parent relations.
-func (b *builder) writeLikelyData() {
-	const (
-		isList = 1 << iota
-		scriptInFrom
-		regionInFrom
-	)
-	type ( // generated types
-		likelyScriptRegion struct {
-			region uint16
-			script uint8
-			flags  uint8
-		}
-		likelyLangScript struct {
-			lang   uint16
-			script uint8
-			flags  uint8
-		}
-		likelyLangRegion struct {
-			lang   uint16
-			region uint16
-		}
-		// likelyTag is used for getting likely tags for group regions, where
-		// the likely region might be a region contained in the group.
-		likelyTag struct {
-			lang   uint16
-			region uint16
-			script uint8
-		}
-	)
-	var ( // generated variables
-		likelyRegionGroup = make([]likelyTag, len(b.groups))
-		likelyLang        = make([]likelyScriptRegion, len(b.lang.s))
-		likelyRegion      = make([]likelyLangScript, len(b.region.s))
-		likelyScript      = make([]likelyLangRegion, len(b.script.s))
-		likelyLangList    = []likelyScriptRegion{}
-		likelyRegionList  = []likelyLangScript{}
-	)
-	type fromTo struct {
-		from, to []string
-	}
-	langToOther := map[int][]fromTo{}
-	regionToOther := map[int][]fromTo{}
-	for _, m := range b.supp.LikelySubtags.LikelySubtag {
-		from := strings.Split(m.From, "_")
-		to := strings.Split(m.To, "_")
-		if len(to) != 3 {
-			log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to))
-		}
-		if len(from) > 3 {
-			log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from))
-		}
-		if from[0] != to[0] && from[0] != "und" {
-			log.Fatalf("unexpected language change in expansion: %s -> %s", from, to)
-		}
-		if len(from) == 3 {
-			if from[2] != to[2] {
-				log.Fatalf("unexpected region change in expansion: %s -> %s", from, to)
-			}
-			if from[0] != "und" {
-				log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to)
-			}
-		}
-		if len(from) == 1 || from[0] != "und" {
-			id := 0
-			if from[0] != "und" {
-				id = b.lang.index(from[0])
-			}
-			langToOther[id] = append(langToOther[id], fromTo{from, to})
-		} else if len(from) == 2 && len(from[1]) == 4 {
-			sid := b.script.index(from[1])
-			likelyScript[sid].lang = uint16(b.langIndex(to[0]))
-			likelyScript[sid].region = uint16(b.region.index(to[2]))
-		} else {
-			r := b.region.index(from[len(from)-1])
-			if id, ok := b.groups[r]; ok {
-				if from[0] != "und" {
-					log.Fatalf("region changed unexpectedly: %s -> %s", from, to)
-				}
-				likelyRegionGroup[id].lang = uint16(b.langIndex(to[0]))
-				likelyRegionGroup[id].script = uint8(b.script.index(to[1]))
-				likelyRegionGroup[id].region = uint16(b.region.index(to[2]))
-			} else {
-				regionToOther[r] = append(regionToOther[r], fromTo{from, to})
-			}
-		}
-	}
-	b.writeType(likelyLangRegion{})
-	b.writeSlice("likelyScript", likelyScript)
-
-	for id := range b.lang.s {
-		list := langToOther[id]
-		if len(list) == 1 {
-			likelyLang[id].region = uint16(b.region.index(list[0].to[2]))
-			likelyLang[id].script = uint8(b.script.index(list[0].to[1]))
-		} else if len(list) > 1 {
-			likelyLang[id].flags = isList
-			likelyLang[id].region = uint16(len(likelyLangList))
-			likelyLang[id].script = uint8(len(list))
-			for _, x := range list {
-				flags := uint8(0)
-				if len(x.from) > 1 {
-					if x.from[1] == x.to[2] {
-						flags = regionInFrom
-					} else {
-						flags = scriptInFrom
-					}
-				}
-				likelyLangList = append(likelyLangList, likelyScriptRegion{
-					region: uint16(b.region.index(x.to[2])),
-					script: uint8(b.script.index(x.to[1])),
-					flags:  flags,
-				})
-			}
-		}
-	}
-	// TODO: merge suppressScript data with this table.
-	b.writeType(likelyScriptRegion{})
-	b.writeSlice("likelyLang", likelyLang)
-	b.writeSlice("likelyLangList", likelyLangList)
-
-	for id := range b.region.s {
-		list := regionToOther[id]
-		if len(list) == 1 {
-			likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0]))
-			likelyRegion[id].script = uint8(b.script.index(list[0].to[1]))
-			if len(list[0].from) > 2 {
-				likelyRegion[id].flags = scriptInFrom
-			}
-		} else if len(list) > 1 {
-			likelyRegion[id].flags = isList
-			likelyRegion[id].lang = uint16(len(likelyRegionList))
-			likelyRegion[id].script = uint8(len(list))
-			for i, x := range list {
-				if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 {
-					log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i)
-				}
-				x := likelyLangScript{
-					lang:   uint16(b.langIndex(x.to[0])),
-					script: uint8(b.script.index(x.to[1])),
-				}
-				if len(list[0].from) > 2 {
-					x.flags = scriptInFrom
-				}
-				likelyRegionList = append(likelyRegionList, x)
-			}
-		}
-	}
-	b.writeType(likelyLangScript{})
-	b.writeSlice("likelyRegion", likelyRegion)
-	b.writeSlice("likelyRegionList", likelyRegionList)
-
-	b.writeType(likelyTag{})
-	b.writeSlice("likelyRegionGroup", likelyRegionGroup)
+func (b *builder) writeConstants() {
+	b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
+	b.writeConsts(b.region, regionConsts...)
+	b.writeConsts(b.script, scriptConsts...)
 }
 
 type mutualIntelligibility struct {
@@ -1397,7 +237,7 @@
 		regions := strings.Split(g.Contains, " ")
 		regionHierarchy[g.Type] = append(regionHierarchy[g.Type], regions...)
 	}
-	regionToGroups := make([]uint8, len(b.region.s))
+	regionToGroups := make([]uint8, language.NumRegions)
 
 	idToIndex := map[string]uint8{}
 	for i, mv := range lm[0].MatchVariable {
@@ -1545,168 +385,15 @@
 	b.writeSlice("matchRegion", matchRegion)
 }
 
-func (b *builder) writeRegionInclusionData() {
-	var (
-		// mm holds for each group the set of groups with a distance of 1.
-		mm = make(map[int][]index)
-
-		// containment holds for each group the transitive closure of
-		// containment of other groups.
-		containment = make(map[index][]index)
-	)
-	for _, g := range b.supp.TerritoryContainment.Group {
-		// Skip UN and EURO zone as they are flattening the containment
-		// relationship.
-		if g.Type == "EZ" || g.Type == "UN" {
-			continue
-		}
-		group := b.region.index(g.Type)
-		groupIdx := b.groups[group]
-		for _, mem := range strings.Split(g.Contains, " ") {
-			r := b.region.index(mem)
-			mm[r] = append(mm[r], groupIdx)
-			if g, ok := b.groups[r]; ok {
-				mm[group] = append(mm[group], g)
-				containment[groupIdx] = append(containment[groupIdx], g)
-			}
-		}
-	}
-
-	regionContainment := make([]uint64, len(b.groups))
-	for _, g := range b.groups {
-		l := containment[g]
-
-		// Compute the transitive closure of containment.
-		for i := 0; i < len(l); i++ {
-			l = append(l, containment[l[i]]...)
-		}
-
-		// Compute the bitmask.
-		regionContainment[g] = 1 << g
-		for _, v := range l {
-			regionContainment[g] |= 1 << v
-		}
-	}
-	b.writeSlice("regionContainment", regionContainment)
-
-	regionInclusion := make([]uint8, len(b.region.s))
-	bvs := make(map[uint64]index)
-	// Make the first bitvector positions correspond with the groups.
-	for r, i := range b.groups {
-		bv := uint64(1 << i)
-		for _, g := range mm[r] {
-			bv |= 1 << g
-		}
-		bvs[bv] = i
-		regionInclusion[r] = uint8(bvs[bv])
-	}
-	for r := 1; r < len(b.region.s); r++ {
-		if _, ok := b.groups[r]; !ok {
-			bv := uint64(0)
-			for _, g := range mm[r] {
-				bv |= 1 << g
-			}
-			if bv == 0 {
-				// Pick the world for unspecified regions.
-				bv = 1 << b.groups[b.region.index("001")]
-			}
-			if _, ok := bvs[bv]; !ok {
-				bvs[bv] = index(len(bvs))
-			}
-			regionInclusion[r] = uint8(bvs[bv])
-		}
-	}
-	b.writeSlice("regionInclusion", regionInclusion)
-	regionInclusionBits := make([]uint64, len(bvs))
-	for k, v := range bvs {
-		regionInclusionBits[v] = uint64(k)
-	}
-	// Add bit vectors for increasingly large distances until a fixed point is reached.
-	regionInclusionNext := []uint8{}
-	for i := 0; i < len(regionInclusionBits); i++ {
-		bits := regionInclusionBits[i]
-		next := bits
-		for i := uint(0); i < uint(len(b.groups)); i++ {
-			if bits&(1<<i) != 0 {
-				next |= regionInclusionBits[i]
-			}
-		}
-		if _, ok := bvs[next]; !ok {
-			bvs[next] = index(len(bvs))
-			regionInclusionBits = append(regionInclusionBits, next)
-		}
-		regionInclusionNext = append(regionInclusionNext, uint8(bvs[next]))
-	}
-	b.writeSlice("regionInclusionBits", regionInclusionBits)
-	b.writeSlice("regionInclusionNext", regionInclusionNext)
-}
-
-type parentRel struct {
-	lang       uint16
-	script     uint8
-	maxScript  uint8
-	toRegion   uint16
-	fromRegion []uint16
-}
-
-func (b *builder) writeParents() {
-	b.writeType(parentRel{})
-
-	parents := []parentRel{}
-
-	// Construct parent overrides.
-	n := 0
-	for _, p := range b.data.Supplemental().ParentLocales.ParentLocale {
-		// Skipping non-standard scripts to root is implemented using addTags.
-		if p.Parent == "root" {
-			continue
-		}
-
-		sub := strings.Split(p.Parent, "_")
-		parent := parentRel{lang: b.langIndex(sub[0])}
-		if len(sub) == 2 {
-			// TODO: check that all undefined scripts are indeed Latn in these
-			// cases.
-			parent.maxScript = uint8(b.script.index("Latn"))
-			parent.toRegion = uint16(b.region.index(sub[1]))
-		} else {
-			parent.script = uint8(b.script.index(sub[1]))
-			parent.maxScript = parent.script
-			parent.toRegion = uint16(b.region.index(sub[2]))
-		}
-		for _, c := range strings.Split(p.Locales, " ") {
-			region := b.region.index(c[strings.LastIndex(c, "_")+1:])
-			parent.fromRegion = append(parent.fromRegion, uint16(region))
-		}
-		parents = append(parents, parent)
-		n += len(parent.fromRegion)
-	}
-	b.writeSliceAddSize("parents", n*2, parents)
-}
-
 func main() {
 	gen.Init()
 
-	gen.Repackage("gen_common.go", "common.go", "language")
-
 	w := gen.NewCodeWriter()
 	defer w.WriteGoFile("tables.go", "language")
 
-	fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`)
-
 	b := newBuilder(w)
 	gen.WriteCLDRVersion(w)
 
-	b.parseIndices()
-	b.writeType(fromTo{})
-	b.writeLanguage()
-	b.writeScript()
-	b.writeRegion()
-	b.writeVariant()
-	// TODO: b.writeLocale()
-	b.computeRegionGroups()
-	b.writeLikelyData()
+	b.writeConstants()
 	b.writeMatchData()
-	b.writeRegionInclusionData()
-	b.writeParents()
 }
diff --git a/language/gen_common.go b/language/gen_common.go
deleted file mode 100644
index 83ce180..0000000
--- a/language/gen_common.go
+++ /dev/null
@@ -1,20 +0,0 @@
-// Copyright 2014 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-package main
-
-// This file contains code common to the maketables.go and the package code.
-
-// langAliasType is the type of an alias in langAliasMap.
-type langAliasType int8
-
-const (
-	langDeprecated langAliasType = iota
-	langMacro
-	langLegacy
-
-	langAliasTypeUnknown langAliasType = -1
-)
diff --git a/language/index.go b/language/index.go
index 5311e5c..f0ed2b8 100644
--- a/language/index.go
+++ b/language/index.go
@@ -1,14 +1,15 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
 package language
 
+import "golang.org/x/text/language/internal"
+
 // NumCompactTags is the number of common tags. The maximum tag is
 // NumCompactTags-1.
 const NumCompactTags = 768
 
-var specialTags = []Tag{ // 2 elements
-	0: {lang: 0xd7, region: 0x6e, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"},
-	1: {lang: 0x139, region: 0x135, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"},
+// TODO: manually updated. Will be automated again in follow-up CL.
+var specialTags = []language.Tag{ // 2 elements
+	0: language.MustParse("ca-ES-valencia"),
+	1: language.MustParse("en-US-u-va-posix"),
 } // Size: 72 bytes
 
 var coreTags = map[uint32]uint16{
diff --git a/language/language.go b/language/language.go
index f81f976..ea4eb9b 100644
--- a/language/language.go
+++ b/language/language.go
@@ -2,8 +2,7 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
-//go:generate go run gen.go gen_common.go -output tables.go
-//go:generate go run gen_index.go
+//go:generate go run gen.go -output tables.go
 
 package language
 
@@ -11,47 +10,22 @@
 // - verifying that tables are dropped correctly (most notably matcher tables).
 
 import (
-	"errors"
-	"fmt"
 	"strings"
-)
 
-const (
-	// maxCoreSize is the maximum size of a BCP 47 tag without variants and
-	// extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
-	maxCoreSize = 12
-
-	// max99thPercentileSize is a somewhat arbitrary buffer size that presumably
-	// is large enough to hold at least 99% of the BCP 47 tags.
-	max99thPercentileSize = 32
-
-	// maxSimpleUExtensionSize is the maximum size of a -u extension with one
-	// key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
-	maxSimpleUExtensionSize = 14
+	"golang.org/x/text/language/internal"
 )
 
 // Tag represents a BCP 47 language tag. It is used to specify an instance of a
 // specific language or locale. All language tag values are guaranteed to be
 // well-formed.
 type Tag struct {
-	lang   langID
-	region regionID
-	// TODO: we will soon run out of positions for script. Idea: instead of
-	// storing lang, region, and script codes, store only the compact index and
-	// have a lookup table from this code to its expansion. This greatly speeds
-	// up table lookup, speed up common variant cases.
-	// This will also immediately free up 3 extra bytes. Also, the pVariant
-	// field can now be moved to the lookup table, as the compact index uniquely
-	// determines the offset of a possible variant.
-	script   scriptID
-	pVariant byte   // offset in str, includes preceding '-'
-	pExt     uint16 // offset of first extension, includes preceding '-'
-
-	// str is the string representation of the Tag. It will only be used if the
-	// tag has variants or extensions.
-	str string
+	tag language.Tag
 }
 
+func (t *Tag) lang() language.Language { return t.tag.LangID }
+func (t *Tag) region() language.Region { return t.tag.RegionID }
+func (t *Tag) script() language.Script { return t.tag.ScriptID }
+
 // Make is a convenience wrapper for Parse that omits the error.
 // In case of an error, a sensible default is returned.
 func Make(s string) Tag {
@@ -68,25 +42,17 @@
 // Raw returns the raw base language, script and region, without making an
 // attempt to infer their values.
 func (t Tag) Raw() (b Base, s Script, r Region) {
-	return Base{t.lang}, Script{t.script}, Region{t.region}
-}
-
-// equalTags compares language, script and region subtags only.
-func (t Tag) equalTags(a Tag) bool {
-	return t.lang == a.lang && t.script == a.script && t.region == a.region
+	return Base{t.tag.LangID}, Script{t.tag.ScriptID}, Region{t.tag.RegionID}
 }
 
 // IsRoot returns true if t is equal to language "und".
 func (t Tag) IsRoot() bool {
-	if int(t.pVariant) < len(t.str) {
-		return false
-	}
-	return t.equalTags(und)
+	return t.tag.IsRoot()
 }
 
 // private reports whether the Tag consists solely of a private use tag.
 func (t Tag) private() bool {
-	return t.str != "" && t.pVariant == 0
+	return t.tag.IsPrivateUse()
 }
 
 // CanonType can be used to enable or disable various types of canonicalization.
@@ -138,30 +104,30 @@
 
 // canonicalize returns the canonicalized equivalent of the tag and
 // whether there was any change.
-func (t Tag) canonicalize(c CanonType) (Tag, bool) {
+func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) {
 	if c == Raw {
 		return t, false
 	}
 	changed := false
 	if c&SuppressScript != 0 {
-		if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] {
-			t.script = 0
+		if t.LangID.SuppressScript() == t.ScriptID {
+			t.ScriptID = 0
 			changed = true
 		}
 	}
 	if c&canonLang != 0 {
 		for {
-			if l, aliasType := normLang(t.lang); l != t.lang {
+			if l, aliasType := t.LangID.Canonicalize(); l != t.LangID {
 				switch aliasType {
-				case langLegacy:
+				case language.Legacy:
 					if c&Legacy != 0 {
-						if t.lang == _sh && t.script == 0 {
-							t.script = _Latn
+						if t.LangID == _sh && t.ScriptID == 0 {
+							t.ScriptID = _Latn
 						}
-						t.lang = l
+						t.LangID = l
 						changed = true
 					}
-				case langMacro:
+				case language.Macro:
 					if c&Macro != 0 {
 						// We deviate here from CLDR. The mapping "nb" -> "no"
 						// qualifies as a typical Macro language mapping.  However,
@@ -172,39 +138,39 @@
 						// http://unicode.org/cldr/trac/ticket/1790 for some of the
 						// practical implications. TODO: this check could be removed
 						// if CLDR adopts this change.
-						if c&CLDR == 0 || t.lang != _nb {
+						if c&CLDR == 0 || t.LangID != _nb {
 							changed = true
-							t.lang = l
+							t.LangID = l
 						}
 					}
-				case langDeprecated:
+				case language.Deprecated:
 					if c&DeprecatedBase != 0 {
-						if t.lang == _mo && t.region == 0 {
-							t.region = _MD
+						if t.LangID == _mo && t.RegionID == 0 {
+							t.RegionID = _MD
 						}
-						t.lang = l
+						t.LangID = l
 						changed = true
 						// Other canonicalization types may still apply.
 						continue
 					}
 				}
-			} else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 {
-				t.lang = _nb
+			} else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 {
+				t.LangID = _nb
 				changed = true
 			}
 			break
 		}
 	}
 	if c&DeprecatedScript != 0 {
-		if t.script == _Qaai {
+		if t.ScriptID == _Qaai {
 			changed = true
-			t.script = _Zinh
+			t.ScriptID = _Zinh
 		}
 	}
 	if c&DeprecatedRegion != 0 {
-		if r := normRegion(t.region); r != 0 {
+		if r := t.RegionID.Canonicalize(); r != t.RegionID {
 			changed = true
-			t.region = r
+			t.RegionID = r
 		}
 	}
 	return t, changed
@@ -212,11 +178,11 @@
 
 // Canonicalize returns the canonicalized equivalent of the tag.
 func (c CanonType) Canonicalize(t Tag) (Tag, error) {
-	t, changed := t.canonicalize(c)
+	tt, changed := canonicalize(c, t.tag)
 	if changed {
-		t.remakeString()
+		tt.RemakeString()
 	}
-	return t, nil
+	return Tag{tt}, nil
 }
 
 // Confidence indicates the level of certainty for a given return value.
@@ -239,99 +205,35 @@
 	return confName[c]
 }
 
-// remakeString is used to update t.str in case lang, script or region changed.
-// It is assumed that pExt and pVariant still point to the start of the
-// respective parts.
-func (t *Tag) remakeString() {
-	if t.str == "" {
-		return
-	}
-	extra := t.str[t.pVariant:]
-	if t.pVariant > 0 {
-		extra = extra[1:]
-	}
-	if t.equalTags(und) && strings.HasPrefix(extra, "x-") {
-		t.str = extra
-		t.pVariant = 0
-		t.pExt = 0
-		return
-	}
-	var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
-	b := buf[:t.genCoreBytes(buf[:])]
-	if extra != "" {
-		diff := len(b) - int(t.pVariant)
-		b = append(b, '-')
-		b = append(b, extra...)
-		t.pVariant = uint8(int(t.pVariant) + diff)
-		t.pExt = uint16(int(t.pExt) + diff)
-	} else {
-		t.pVariant = uint8(len(b))
-		t.pExt = uint16(len(b))
-	}
-	t.str = string(b)
-}
-
-// genCoreBytes writes a string for the base languages, script and region tags
-// to the given buffer and returns the number of bytes written. It will never
-// write more than maxCoreSize bytes.
-func (t *Tag) genCoreBytes(buf []byte) int {
-	n := t.lang.stringToBuf(buf[:])
-	if t.script != 0 {
-		n += copy(buf[n:], "-")
-		n += copy(buf[n:], t.script.String())
-	}
-	if t.region != 0 {
-		n += copy(buf[n:], "-")
-		n += copy(buf[n:], t.region.String())
-	}
-	return n
-}
-
 // String returns the canonical string representation of the language tag.
 func (t Tag) String() string {
-	if t.str != "" {
-		return t.str
-	}
-	if t.script == 0 && t.region == 0 {
-		return t.lang.String()
-	}
-	buf := [maxCoreSize]byte{}
-	return string(buf[:t.genCoreBytes(buf[:])])
+	return t.tag.String()
 }
 
 // MarshalText implements encoding.TextMarshaler.
 func (t Tag) MarshalText() (text []byte, err error) {
-	if t.str != "" {
-		text = append(text, t.str...)
-	} else if t.script == 0 && t.region == 0 {
-		text = append(text, t.lang.String()...)
-	} else {
-		buf := [maxCoreSize]byte{}
-		text = buf[:t.genCoreBytes(buf[:])]
-	}
-	return text, nil
+	return t.tag.MarshalText()
 }
 
 // UnmarshalText implements encoding.TextUnmarshaler.
 func (t *Tag) UnmarshalText(text []byte) error {
-	tag, err := Raw.Parse(string(text))
-	*t = tag
-	return err
+	return t.tag.UnmarshalText(text)
 }
 
 // Base returns the base language of the language tag. If the base language is
 // unspecified, an attempt will be made to infer it from the context.
 // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
 func (t Tag) Base() (Base, Confidence) {
-	if t.lang != 0 {
-		return Base{t.lang}, Exact
+	if b := t.lang(); b != 0 {
+		return Base{b}, Exact
 	}
+	tt := t.tag
 	c := High
-	if t.script == 0 && !(Region{t.region}).IsCountry() {
+	if tt.ScriptID == 0 && !tt.RegionID.IsCountry() {
 		c = Low
 	}
-	if tag, err := addTags(t); err == nil && tag.lang != 0 {
-		return Base{tag.lang}, c
+	if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 {
+		return Base{tag.LangID}, c
 	}
 	return Base{0}, No
 }
@@ -351,28 +253,27 @@
 // in the past.  Also, the script that is commonly used may change over time.
 // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
 func (t Tag) Script() (Script, Confidence) {
-	if t.script != 0 {
-		return Script{t.script}, Exact
+	if t.script() != 0 {
+		return Script{t.script()}, Exact
 	}
+	tt := t.tag
 	sc, c := scriptID(_Zzzz), No
-	if t.lang < langNoIndexOffset {
-		if scr := scriptID(suppressScript[t.lang]); scr != 0 {
-			// Note: it is not always the case that a language with a suppress
-			// script value is only written in one script (e.g. kk, ms, pa).
-			if t.region == 0 {
-				return Script{scriptID(scr)}, High
-			}
-			sc, c = scr, High
+	if scr := tt.LangID.SuppressScript(); scr != 0 {
+		// Note: it is not always the case that a language with a suppress
+		// script value is only written in one script (e.g. kk, ms, pa).
+		if tt.RegionID == 0 {
+			return Script{scr}, High
 		}
+		sc, c = scr, High
 	}
-	if tag, err := addTags(t); err == nil {
-		if tag.script != sc {
-			sc, c = tag.script, Low
+	if tag, err := tt.Maximize(); err == nil {
+		if tag.ScriptID != sc {
+			sc, c = tag.ScriptID, Low
 		}
 	} else {
 		t, _ = (Deprecated | Macro).Canonicalize(t)
-		if tag, err := addTags(t); err == nil && tag.script != sc {
-			sc, c = tag.script, Low
+		if tag, err := t.tag.Maximize(); err == nil && tag.ScriptID != sc {
+			sc, c = tag.ScriptID, Low
 		}
 	}
 	return Script{sc}, c
@@ -382,28 +283,28 @@
 // infer a most likely candidate from the context.
 // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
 func (t Tag) Region() (Region, Confidence) {
-	if t.region != 0 {
-		return Region{t.region}, Exact
+	if t.region() != 0 {
+		return Region{t.region()}, Exact
 	}
-	if t, err := addTags(t); err == nil {
-		return Region{t.region}, Low // TODO: differentiate between high and low.
+	tt := t.tag
+	if tt, err := tt.Maximize(); err == nil {
+		return Region{tt.RegionID}, Low // TODO: differentiate between high and low.
 	}
 	t, _ = (Deprecated | Macro).Canonicalize(t)
-	if tag, err := addTags(t); err == nil {
-		return Region{tag.region}, Low
+	if tag, err := t.tag.Maximize(); err == nil {
+		return Region{tag.RegionID}, Low
 	}
 	return Region{_ZZ}, No // TODO: return world instead of undetermined?
 }
 
-// Variant returns the variants specified explicitly for this language tag.
+// Variants returns the variants specified explicitly for this language tag.
 // or nil if no variant was specified.
 func (t Tag) Variants() []Variant {
 	v := []Variant{}
-	if int(t.pVariant) < int(t.pExt) {
-		for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; {
-			x, str = nextToken(str)
-			v = append(v, Variant{x})
-		}
+	x, str := "", t.tag.Variants()
+	for str != "" {
+		x, str = nextToken(str)
+		v = append(v, Variant{x})
 	}
 	return v
 }
@@ -412,56 +313,7 @@
 // specific language are substituted with fields from the parent language.
 // The parent for a language may change for newer versions of CLDR.
 func (t Tag) Parent() Tag {
-	if t.str != "" {
-		// Strip the variants and extensions.
-		t, _ = Raw.Compose(t.Raw())
-		if t.region == 0 && t.script != 0 && t.lang != 0 {
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script == t.script {
-				return Tag{lang: t.lang}
-			}
-		}
-		return t
-	}
-	if t.lang != 0 {
-		if t.region != 0 {
-			maxScript := t.script
-			if maxScript == 0 {
-				max, _ := addTags(t)
-				maxScript = max.script
-			}
-
-			for i := range parents {
-				if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript {
-					for _, r := range parents[i].fromRegion {
-						if regionID(r) == t.region {
-							return Tag{
-								lang:   t.lang,
-								script: scriptID(parents[i].script),
-								region: regionID(parents[i].toRegion),
-							}
-						}
-					}
-				}
-			}
-
-			// Strip the script if it is the default one.
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script != maxScript {
-				return Tag{lang: t.lang, script: maxScript}
-			}
-			return Tag{lang: t.lang}
-		} else if t.script != 0 {
-			// The parent for an base-script pair with a non-default script is
-			// "und" instead of the base language.
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script != t.script {
-				return und
-			}
-			return Tag{lang: t.lang}
-		}
-	}
-	return und
+	return Tag{t.tag.Parent()}
 }
 
 // returns token t and the rest of the string.
@@ -487,17 +339,8 @@
 
 // ParseExtension parses s as an extension and returns it on success.
 func ParseExtension(s string) (e Extension, err error) {
-	scan := makeScannerString(s)
-	var end int
-	if n := len(scan.token); n != 1 {
-		return Extension{}, errSyntax
-	}
-	scan.toLower(0, len(scan.b))
-	end = parseExtension(&scan)
-	if end != len(s) {
-		return Extension{}, errSyntax
-	}
-	return Extension{string(scan.b)}, nil
+	ext, err := language.ParseExtension(s)
+	return Extension{ext}, err
 }
 
 // Type returns the one-byte extension type of e. It returns 0 for the zero
@@ -518,22 +361,14 @@
 // false for ok if t does not have the requested extension. The returned
 // extension will be invalid in this case.
 func (t Tag) Extension(x byte) (ext Extension, ok bool) {
-	for i := int(t.pExt); i < len(t.str)-1; {
-		var ext string
-		i, ext = getExtension(t.str, i)
-		if ext[0] == x {
-			return Extension{ext}, true
-		}
-	}
-	return Extension{}, false
+	e, ok := t.tag.Extension(x)
+	return Extension{e}, ok
 }
 
 // Extensions returns all extensions of t.
 func (t Tag) Extensions() []Extension {
 	e := []Extension{}
-	for i := int(t.pExt); i < len(t.str)-1; {
-		var ext string
-		i, ext = getExtension(t.str, i)
+	for _, ext := range t.tag.Extensions() {
 		e = append(e, Extension{ext})
 	}
 	return e
@@ -544,162 +379,16 @@
 // http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
 // TypeForKey will traverse the inheritance chain to get the correct value.
 func (t Tag) TypeForKey(key string) string {
-	if start, end, _ := t.findTypeForKey(key); end != start {
-		return t.str[start:end]
-	}
-	return ""
+	return t.tag.TypeForKey(key)
 }
 
-var (
-	errPrivateUse       = errors.New("cannot set a key on a private use tag")
-	errInvalidArguments = errors.New("invalid key or type")
-)
-
 // SetTypeForKey returns a new Tag with the key set to type, where key and type
 // are of the allowed values defined for the Unicode locale extension ('u') in
 // http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
 // An empty value removes an existing pair with the same key.
 func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
-	if t.private() {
-		return t, errPrivateUse
-	}
-	if len(key) != 2 {
-		return t, errInvalidArguments
-	}
-
-	// Remove the setting if value is "".
-	if value == "" {
-		start, end, _ := t.findTypeForKey(key)
-		if start != end {
-			// Remove key tag and leading '-'.
-			start -= 4
-
-			// Remove a possible empty extension.
-			if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
-				start -= 2
-			}
-			if start == int(t.pVariant) && end == len(t.str) {
-				t.str = ""
-				t.pVariant, t.pExt = 0, 0
-			} else {
-				t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
-			}
-		}
-		return t, nil
-	}
-
-	if len(value) < 3 || len(value) > 8 {
-		return t, errInvalidArguments
-	}
-
-	var (
-		buf    [maxCoreSize + maxSimpleUExtensionSize]byte
-		uStart int // start of the -u extension.
-	)
-
-	// Generate the tag string if needed.
-	if t.str == "" {
-		uStart = t.genCoreBytes(buf[:])
-		buf[uStart] = '-'
-		uStart++
-	}
-
-	// Create new key-type pair and parse it to verify.
-	b := buf[uStart:]
-	copy(b, "u-")
-	copy(b[2:], key)
-	b[4] = '-'
-	b = b[:5+copy(b[5:], value)]
-	scan := makeScanner(b)
-	if parseExtensions(&scan); scan.err != nil {
-		return t, scan.err
-	}
-
-	// Assemble the replacement string.
-	if t.str == "" {
-		t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
-		t.str = string(buf[:uStart+len(b)])
-	} else {
-		s := t.str
-		start, end, hasExt := t.findTypeForKey(key)
-		if start == end {
-			if hasExt {
-				b = b[2:]
-			}
-			t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
-		} else {
-			t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
-		}
-	}
-	return t, nil
-}
-
-// findKeyAndType returns the start and end position for the type corresponding
-// to key or the point at which to insert the key-value pair if the type
-// wasn't found. The hasExt return value reports whether an -u extension was present.
-// Note: the extensions are typically very small and are likely to contain
-// only one key-type pair.
-func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
-	p := int(t.pExt)
-	if len(key) != 2 || p == len(t.str) || p == 0 {
-		return p, p, false
-	}
-	s := t.str
-
-	// Find the correct extension.
-	for p++; s[p] != 'u'; p++ {
-		if s[p] > 'u' {
-			p--
-			return p, p, false
-		}
-		if p = nextExtension(s, p); p == len(s) {
-			return len(s), len(s), false
-		}
-	}
-	// Proceed to the hyphen following the extension name.
-	p++
-
-	// curKey is the key currently being processed.
-	curKey := ""
-
-	// Iterate over keys until we get the end of a section.
-	for {
-		// p points to the hyphen preceding the current token.
-		if p3 := p + 3; s[p3] == '-' {
-			// Found a key.
-			// Check whether we just processed the key that was requested.
-			if curKey == key {
-				return start, p, true
-			}
-			// Set to the next key and continue scanning type tokens.
-			curKey = s[p+1 : p3]
-			if curKey > key {
-				return p, p, true
-			}
-			// Start of the type token sequence.
-			start = p + 4
-			// A type is at least 3 characters long.
-			p += 7 // 4 + 3
-		} else {
-			// Attribute or type, which is at least 3 characters long.
-			p += 4
-		}
-		// p points past the third character of a type or attribute.
-		max := p + 5 // maximum length of token plus hyphen.
-		if len(s) < max {
-			max = len(s)
-		}
-		for ; p < max && s[p] != '-'; p++ {
-		}
-		// Bail if we have exhausted all tokens or if the next token starts
-		// a new extension.
-		if p == len(s) || s[p+2] == '-' {
-			if curKey == key {
-				return start, p, true
-			}
-			return p, p, true
-		}
-	}
+	tt, err := t.tag.SetTypeForKey(key, value)
+	return Tag{tt}, err
 }
 
 // CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags
@@ -715,16 +404,18 @@
 
 	b, s, r := t.Raw()
 	switch {
-	case len(t.str) > 0:
-		if strings.HasPrefix(t.str, "x-") {
+	case t.tag.HasString():
+		if t.private() {
 			// We have no entries for user-defined tags.
 			return 0, false
 		}
-		if uint16(t.pVariant) != t.pExt {
-			if int(t.pExt) < len(t.str) {
+		hasExtra := false
+		if t.tag.HasVariants() {
+			if t.tag.HasExtensions() {
 				exact = false
 				t, _ = Raw.Compose(b, s, r, t.Variants())
 			}
+			hasExtra = true
 		} else if _, ok := t.Extension('u'); ok {
 			// TODO: va may mean something else. Consider not considering it.
 			// Strip all but the 'va' entry.
@@ -733,13 +424,14 @@
 			t, _ = Raw.Compose(b, s, r)
 			if variant != "" {
 				t, _ = t.SetTypeForKey("va", variant)
+				hasExtra = true
 			}
 			exact = old == t
 		}
-		if len(t.str) > 0 {
+		if hasExtra {
 			// We have some variants.
 			for i, s := range specialTags {
-				if s == t {
+				if s == t.tag {
 					return i + 1, exact
 				}
 			}
@@ -764,48 +456,66 @@
 // Base is an ISO 639 language code, used for encoding the base language
 // of a language tag.
 type Base struct {
-	langID
+	langID language.Language
 }
 
 // ParseBase parses a 2- or 3-letter ISO 639 code.
 // It returns a ValueError if s is a well-formed but unknown language identifier
 // or another error if another error occurred.
 func ParseBase(s string) (Base, error) {
-	if n := len(s); n < 2 || 3 < n {
-		return Base{}, errSyntax
-	}
-	var buf [3]byte
-	l, err := getLangID(buf[:copy(buf[:], s)])
+	l, err := language.ParseBase(s)
 	return Base{l}, err
 }
 
+// String returns the BCP 47 representation of the base language.
+func (b Base) String() string {
+	return b.langID.String()
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b Base) ISO3() string {
+	return b.langID.ISO3()
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b Base) IsPrivateUse() bool {
+	return b.langID.IsPrivateUse()
+}
+
 // Script is a 4-letter ISO 15924 code for representing scripts.
 // It is idiomatically represented in title case.
 type Script struct {
-	scriptID
+	scriptID language.Script
 }
 
 // ParseScript parses a 4-letter ISO 15924 code.
 // It returns a ValueError if s is a well-formed but unknown script identifier
 // or another error if another error occurred.
 func ParseScript(s string) (Script, error) {
-	if len(s) != 4 {
-		return Script{}, errSyntax
-	}
-	var buf [4]byte
-	sc, err := getScriptID(script, buf[:copy(buf[:], s)])
+	sc, err := language.ParseScript(s)
 	return Script{sc}, err
 }
 
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s Script) String() string {
+	return s.scriptID.String()
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s Script) IsPrivateUse() bool {
+	return s.scriptID.IsPrivateUse()
+}
+
 // Region is an ISO 3166-1 or UN M.49 code for representing countries and regions.
 type Region struct {
-	regionID
+	regionID language.Region
 }
 
 // EncodeM49 returns the Region for the given UN M.49 code.
 // It returns an error if r is not a valid code.
 func EncodeM49(r int) (Region, error) {
-	rid, err := getRegionM49(r)
+	rid, err := language.EncodeM49(r)
 	return Region{rid}, err
 }
 
@@ -813,62 +523,54 @@
 // It returns a ValueError if s is a well-formed but unknown region identifier
 // or another error if another error occurred.
 func ParseRegion(s string) (Region, error) {
-	if n := len(s); n < 2 || 3 < n {
-		return Region{}, errSyntax
-	}
-	var buf [3]byte
-	r, err := getRegionID(buf[:copy(buf[:], s)])
+	r, err := language.ParseRegion(s)
 	return Region{r}, err
 }
 
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r Region) String() string {
+	return r.regionID.String()
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r Region) ISO3() string {
+	return r.regionID.String()
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r Region) M49() int {
+	return r.regionID.M49()
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r Region) IsPrivateUse() bool {
+	return r.regionID.IsPrivateUse()
+}
+
 // IsCountry returns whether this region is a country or autonomous area. This
 // includes non-standard definitions from CLDR.
 func (r Region) IsCountry() bool {
-	if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK {
-		return false
-	}
-	return true
+	return r.regionID.IsCountry()
 }
 
 // IsGroup returns whether this region defines a collection of regions. This
 // includes non-standard definitions from CLDR.
 func (r Region) IsGroup() bool {
-	if r.regionID == 0 {
-		return false
-	}
-	return int(regionInclusion[r.regionID]) < len(regionContainment)
+	return r.regionID.IsGroup()
 }
 
 // Contains returns whether Region c is contained by Region r. It returns true
 // if c == r.
 func (r Region) Contains(c Region) bool {
-	return r.regionID.contains(c.regionID)
+	return r.regionID.Contains(c.regionID)
 }
 
-func (r regionID) contains(c regionID) bool {
-	if r == c {
-		return true
-	}
-	g := regionInclusion[r]
-	if g >= nRegionGroups {
-		return false
-	}
-	m := regionContainment[g]
-
-	d := regionInclusion[c]
-	b := regionInclusionBits[d]
-
-	// A contained country may belong to multiple disjoint groups. Matching any
-	// of these indicates containment. If the contained region is a group, it
-	// must strictly be a subset.
-	if d >= nRegionGroups {
-		return b&m != 0
-	}
-	return b&^m == 0
-}
-
-var errNoTLD = errors.New("language: region is not a valid ccTLD")
-
 // TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
 // In all other cases it returns either the region itself or an error.
 //
@@ -877,25 +579,15 @@
 // region will already be canonicalized it was obtained from a Tag that was
 // obtained using any of the default methods.
 func (r Region) TLD() (Region, error) {
-	// See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
-	// difference between ISO 3166-1 and IANA ccTLD.
-	if r.regionID == _GB {
-		r = Region{_UK}
-	}
-	if (r.typ() & ccTLD) == 0 {
-		return Region{}, errNoTLD
-	}
-	return r, nil
+	tld, err := r.regionID.TLD()
+	return Region{tld}, err
 }
 
 // Canonicalize returns the region or a possible replacement if the region is
 // deprecated. It will not return a replacement for deprecated regions that
 // are split into multiple regions.
 func (r Region) Canonicalize() Region {
-	if cr := normRegion(r.regionID); cr != 0 {
-		return Region{cr}
-	}
-	return r
+	return Region{r.regionID.Canonicalize()}
 }
 
 // Variant represents a registered variant of a language as defined by BCP 47.
@@ -906,11 +598,8 @@
 // ParseVariant parses and returns a Variant. An error is returned if s is not
 // a valid variant.
 func ParseVariant(s string) (Variant, error) {
-	s = strings.ToLower(s)
-	if _, ok := variantIndex[s]; ok {
-		return Variant{s}, nil
-	}
-	return Variant{}, mkErrInvalid([]byte(s))
+	v, err := language.ParseVariant(s)
+	return Variant{v.String()}, err
 }
 
 // String returns the string representation of the variant.
diff --git a/language/language_test.go b/language/language_test.go
index 14bc8a7..084a86f 100644
--- a/language/language_test.go
+++ b/language/language_test.go
@@ -7,8 +7,6 @@
 import (
 	"reflect"
 	"testing"
-
-	"golang.org/x/text/internal/testtext"
 )
 
 func TestTagSize(t *testing.T) {
@@ -48,35 +46,6 @@
 	}
 }
 
-func TestMakeString(t *testing.T) {
-	tests := []struct{ in, out string }{
-		{"und", "und"},
-		{"und", "und-CW"},
-		{"nl", "nl-NL"},
-		{"de-1901", "nl-1901"},
-		{"de-1901", "de-Arab-1901"},
-		{"x-a-b", "de-Arab-x-a-b"},
-		{"x-a-b", "x-a-b"},
-	}
-	for i, tt := range tests {
-		id, _ := Parse(tt.in)
-		mod, _ := Parse(tt.out)
-		id.setTagsFrom(mod)
-		for j := 0; j < 2; j++ {
-			id.remakeString()
-			if str := id.String(); str != tt.out {
-				t.Errorf("%d:%d: found %s; want %s", i, j, id.String(), tt.out)
-			}
-		}
-		// The bytes to string conversion as used in remakeString
-		// occasionally measures as more than one alloc, breaking this test.
-		// To alleviate this we set the number of runs to more than 1.
-		if n := testtext.AllocsPerRun(8, id.remakeString); n > 1 {
-			t.Errorf("%d: # allocs got %.1f; want <= 1", i, n)
-		}
-	}
-}
-
 func TestCompactIndex(t *testing.T) {
 	tests := []struct {
 		tag   string
@@ -346,8 +315,7 @@
 		{"XK", true},
 	}
 	for i, tt := range tests {
-		reg, _ := getRegionID([]byte(tt.reg))
-		r := Region{reg}
+		r, _ := ParseRegion(tt.reg)
 		if r.IsCountry() != tt.country {
 			t.Errorf("%d: IsCountry(%s) was %v; want %v", i, tt.reg, r.IsCountry(), tt.country)
 		}
@@ -373,8 +341,7 @@
 		{"XK", false},
 	}
 	for i, tt := range tests {
-		reg, _ := getRegionID([]byte(tt.reg))
-		r := Region{reg}
+		r, _ := ParseRegion(tt.reg)
 		if r.IsGroup() != tt.group {
 			t.Errorf("%d: IsGroup(%s) was %v; want %v", i, tt.reg, r.IsGroup(), tt.group)
 		}
@@ -407,10 +374,9 @@
 		{"155", "EU", false},
 	}
 	for i, tt := range tests {
-		enc, _ := getRegionID([]byte(tt.enclosing))
-		con, _ := getRegionID([]byte(tt.contained))
-		r := Region{enc}
-		if got := r.Contains(Region{con}); got != tt.contains {
+		r := MustParseRegion(tt.enclosing)
+		con := MustParseRegion(tt.contained)
+		if got := r.Contains(con); got != tt.contains {
 			t.Errorf("%d: %s.Contains(%s) was %v; want %v", i, tt.enclosing, tt.contained, got, tt.contains)
 		}
 	}
@@ -565,9 +531,6 @@
 		if in.String() != tt.out {
 			t.Errorf("%d:%s: was %s; want %s", i, tt.in, in.String(), tt.out)
 		}
-		if int(in.pVariant) > int(in.pExt) || int(in.pExt) > len(in.str) {
-			t.Errorf("%d:%s:offsets %d <= %d <= %d must be true", i, tt.in, in.pVariant, in.pExt, len(in.str))
-		}
 	}
 	// Test idempotence.
 	for _, base := range Supported.BaseLanguages() {
@@ -597,121 +560,6 @@
 	}
 }
 
-func TestSetTypeForKey(t *testing.T) {
-	tests := []struct {
-		key, value, in, out string
-		err                 bool
-	}{
-		// replace existing value
-		{"co", "pinyin", "en-u-co-phonebk", "en-u-co-pinyin", false},
-		{"co", "pinyin", "en-u-co-phonebk-cu-xau", "en-u-co-pinyin-cu-xau", false},
-		{"co", "pinyin", "en-u-co-phonebk-v-xx", "en-u-co-pinyin-v-xx", false},
-		{"co", "pinyin", "en-u-co-phonebk-x-x", "en-u-co-pinyin-x-x", false},
-		{"nu", "arabic", "en-u-co-phonebk-nu-vaai", "en-u-co-phonebk-nu-arabic", false},
-		// add to existing -u extension
-		{"co", "pinyin", "en-u-ca-gregory", "en-u-ca-gregory-co-pinyin", false},
-		{"co", "pinyin", "en-u-ca-gregory-nu-vaai", "en-u-ca-gregory-co-pinyin-nu-vaai", false},
-		{"co", "pinyin", "en-u-ca-gregory-v-va", "en-u-ca-gregory-co-pinyin-v-va", false},
-		{"co", "pinyin", "en-u-ca-gregory-x-a", "en-u-ca-gregory-co-pinyin-x-a", false},
-		{"ca", "gregory", "en-u-co-pinyin", "en-u-ca-gregory-co-pinyin", false},
-		// remove pair
-		{"co", "", "en-u-co-phonebk", "en", false},
-		{"co", "", "en-u-ca-gregory-co-phonebk", "en-u-ca-gregory", false},
-		{"co", "", "en-u-co-phonebk-nu-arabic", "en-u-nu-arabic", false},
-		{"co", "", "en", "en", false},
-		// add -u extension
-		{"co", "pinyin", "en", "en-u-co-pinyin", false},
-		{"co", "pinyin", "und", "und-u-co-pinyin", false},
-		{"co", "pinyin", "en-a-aaa", "en-a-aaa-u-co-pinyin", false},
-		{"co", "pinyin", "en-x-aaa", "en-u-co-pinyin-x-aaa", false},
-		{"co", "pinyin", "en-v-aa", "en-u-co-pinyin-v-aa", false},
-		{"co", "pinyin", "en-a-aaa-x-x", "en-a-aaa-u-co-pinyin-x-x", false},
-		{"co", "pinyin", "en-a-aaa-v-va", "en-a-aaa-u-co-pinyin-v-va", false},
-		// error on invalid values
-		{"co", "pinyinxxx", "en", "en", true},
-		{"co", "piny.n", "en", "en", true},
-		{"co", "pinyinxxx", "en-a-aaa", "en-a-aaa", true},
-		{"co", "pinyinxxx", "en-u-aaa", "en-u-aaa", true},
-		{"co", "pinyinxxx", "en-u-aaa-co-pinyin", "en-u-aaa-co-pinyin", true},
-		{"co", "pinyi.", "en-u-aaa-co-pinyin", "en-u-aaa-co-pinyin", true},
-		{"col", "pinyin", "en", "en", true},
-		{"co", "cu", "en", "en", true},
-		// error when setting on a private use tag
-		{"co", "phonebook", "x-foo", "x-foo", true},
-	}
-	for i, tt := range tests {
-		tag := Make(tt.in)
-		if v, err := tag.SetTypeForKey(tt.key, tt.value); v.String() != tt.out {
-			t.Errorf("%d:%q[%q]=%q: was %q; want %q", i, tt.in, tt.key, tt.value, v, tt.out)
-		} else if (err != nil) != tt.err {
-			t.Errorf("%d:%q[%q]=%q: error was %v; want %v", i, tt.in, tt.key, tt.value, err != nil, tt.err)
-		} else if val := v.TypeForKey(tt.key); err == nil && val != tt.value {
-			t.Errorf("%d:%q[%q]==%q: was %v; want %v", i, tt.out, tt.key, tt.value, val, tt.value)
-		}
-		if len(tag.String()) <= 3 {
-			// Simulate a tag for which the string has not been set.
-			tag.str, tag.pExt, tag.pVariant = "", 0, 0
-			if tag, err := tag.SetTypeForKey(tt.key, tt.value); err == nil {
-				if val := tag.TypeForKey(tt.key); err == nil && val != tt.value {
-					t.Errorf("%d:%q[%q]==%q: was %v; want %v", i, tt.out, tt.key, tt.value, val, tt.value)
-				}
-			}
-		}
-	}
-}
-
-func TestFindKeyAndType(t *testing.T) {
-	// out is either the matched type in case of a match or the original
-	// string up till the insertion point.
-	tests := []struct {
-		key     string
-		hasExt  bool
-		in, out string
-	}{
-		// Don't search past a private use extension.
-		{"co", false, "en-x-foo-u-co-pinyin", "en"},
-		{"co", false, "x-foo-u-co-pinyin", ""},
-		{"co", false, "en-s-fff-x-foo", "en-s-fff"},
-		// Insertion points in absence of -u extension.
-		{"cu", false, "en", ""}, // t.str is ""
-		{"cu", false, "en-v-va", "en"},
-		{"cu", false, "en-a-va", "en-a-va"},
-		{"cu", false, "en-a-va-v-va", "en-a-va"},
-		{"cu", false, "en-x-a", "en"},
-		// Tags with the -u extension.
-		{"co", true, "en-u-co-standard", "standard"},
-		{"co", true, "yue-u-co-pinyin", "pinyin"},
-		{"co", true, "en-u-co-abc", "abc"},
-		{"co", true, "en-u-co-abc-def", "abc-def"},
-		{"co", true, "en-u-co-abc-def-x-foo", "abc-def"},
-		{"co", true, "en-u-co-standard-nu-arab", "standard"},
-		{"co", true, "yue-u-co-pinyin-nu-arab", "pinyin"},
-		// Insertion points.
-		{"cu", true, "en-u-co-standard", "en-u-co-standard"},
-		{"cu", true, "yue-u-co-pinyin-x-foo", "yue-u-co-pinyin"},
-		{"cu", true, "en-u-co-abc", "en-u-co-abc"},
-		{"cu", true, "en-u-nu-arabic", "en-u"},
-		{"cu", true, "en-u-co-abc-def-nu-arabic", "en-u-co-abc-def"},
-	}
-	for i, tt := range tests {
-		start, end, hasExt := Make(tt.in).findTypeForKey(tt.key)
-		if start != end {
-			res := tt.in[start:end]
-			if res != tt.out {
-				t.Errorf("%d:%s: was %q; want %q", i, tt.in, res, tt.out)
-			}
-		} else {
-			if hasExt != tt.hasExt {
-				t.Errorf("%d:%s: hasExt was %v; want %v", i, tt.in, hasExt, tt.hasExt)
-				continue
-			}
-			if tt.in[:start] != tt.out {
-				t.Errorf("%d:%s: insertion point was %q; want %q", i, tt.in, tt.in[:start], tt.out)
-			}
-		}
-	}
-}
-
 func TestParent(t *testing.T) {
 	tests := []struct{ in, out string }{
 		// Strip variants and extensions first
diff --git a/language/lookup.go b/language/lookup.go
index 1d80ac3..a59b7e4 100644
--- a/language/lookup.go
+++ b/language/lookup.go
@@ -5,392 +5,11 @@
 package language
 
 import (
-	"bytes"
-	"fmt"
-	"sort"
-	"strconv"
-
-	"golang.org/x/text/internal/tag"
+	"golang.org/x/text/language/internal"
 )
 
-// findIndex tries to find the given tag in idx and returns a standardized error
-// if it could not be found.
-func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
-	if !tag.FixCase(form, key) {
-		return 0, errSyntax
-	}
-	i := idx.Index(key)
-	if i == -1 {
-		return 0, mkErrInvalid(key)
-	}
-	return i, nil
-}
+type langID = language.Language
 
-func searchUint(imap []uint16, key uint16) int {
-	return sort.Search(len(imap), func(i int) bool {
-		return imap[i] >= key
-	})
-}
+type regionID = language.Region
 
-type langID uint16
-
-// getLangID returns the langID of s if s is a canonical subtag
-// or langUnknown if s is not a canonical subtag.
-func getLangID(s []byte) (langID, error) {
-	if len(s) == 2 {
-		return getLangISO2(s)
-	}
-	return getLangISO3(s)
-}
-
-// mapLang returns the mapped langID of id according to mapping m.
-func normLang(id langID) (langID, langAliasType) {
-	k := sort.Search(len(langAliasMap), func(i int) bool {
-		return langAliasMap[i].from >= uint16(id)
-	})
-	if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) {
-		return langID(langAliasMap[k].to), langAliasTypes[k]
-	}
-	return id, langAliasTypeUnknown
-}
-
-// getLangISO2 returns the langID for the given 2-letter ISO language code
-// or unknownLang if this does not exist.
-func getLangISO2(s []byte) (langID, error) {
-	if !tag.FixCase("zz", s) {
-		return 0, errSyntax
-	}
-	if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
-		return langID(i), nil
-	}
-	return 0, mkErrInvalid(s)
-}
-
-const base = 'z' - 'a' + 1
-
-func strToInt(s []byte) uint {
-	v := uint(0)
-	for i := 0; i < len(s); i++ {
-		v *= base
-		v += uint(s[i] - 'a')
-	}
-	return v
-}
-
-// converts the given integer to the original ASCII string passed to strToInt.
-// len(s) must match the number of characters obtained.
-func intToStr(v uint, s []byte) {
-	for i := len(s) - 1; i >= 0; i-- {
-		s[i] = byte(v%base) + 'a'
-		v /= base
-	}
-}
-
-// getLangISO3 returns the langID for the given 3-letter ISO language code
-// or unknownLang if this does not exist.
-func getLangISO3(s []byte) (langID, error) {
-	if tag.FixCase("und", s) {
-		// first try to match canonical 3-letter entries
-		for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
-			if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] {
-				// We treat "und" as special and always translate it to "unspecified".
-				// Note that ZZ and Zzzz are private use and are not treated as
-				// unspecified by default.
-				id := langID(i)
-				if id == nonCanonicalUnd {
-					return 0, nil
-				}
-				return id, nil
-			}
-		}
-		if i := altLangISO3.Index(s); i != -1 {
-			return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil
-		}
-		n := strToInt(s)
-		if langNoIndex[n/8]&(1<<(n%8)) != 0 {
-			return langID(n) + langNoIndexOffset, nil
-		}
-		// Check for non-canonical uses of ISO3.
-		for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
-			if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
-				return langID(i), nil
-			}
-		}
-		return 0, mkErrInvalid(s)
-	}
-	return 0, errSyntax
-}
-
-// stringToBuf writes the string to b and returns the number of bytes
-// written.  cap(b) must be >= 3.
-func (id langID) stringToBuf(b []byte) int {
-	if id >= langNoIndexOffset {
-		intToStr(uint(id)-langNoIndexOffset, b[:3])
-		return 3
-	} else if id == 0 {
-		return copy(b, "und")
-	}
-	l := lang[id<<2:]
-	if l[3] == 0 {
-		return copy(b, l[:3])
-	}
-	return copy(b, l[:2])
-}
-
-// String returns the BCP 47 representation of the langID.
-// Use b as variable name, instead of id, to ensure the variable
-// used is consistent with that of Base in which this type is embedded.
-func (b langID) String() string {
-	if b == 0 {
-		return "und"
-	} else if b >= langNoIndexOffset {
-		b -= langNoIndexOffset
-		buf := [3]byte{}
-		intToStr(uint(b), buf[:])
-		return string(buf[:])
-	}
-	l := lang.Elem(int(b))
-	if l[3] == 0 {
-		return l[:3]
-	}
-	return l[:2]
-}
-
-// ISO3 returns the ISO 639-3 language code.
-func (b langID) ISO3() string {
-	if b == 0 || b >= langNoIndexOffset {
-		return b.String()
-	}
-	l := lang.Elem(int(b))
-	if l[3] == 0 {
-		return l[:3]
-	} else if l[2] == 0 {
-		return altLangISO3.Elem(int(l[3]))[:3]
-	}
-	// This allocation will only happen for 3-letter ISO codes
-	// that are non-canonical BCP 47 language identifiers.
-	return l[0:1] + l[2:4]
-}
-
-// IsPrivateUse reports whether this language code is reserved for private use.
-func (b langID) IsPrivateUse() bool {
-	return langPrivateStart <= b && b <= langPrivateEnd
-}
-
-type regionID uint16
-
-// getRegionID returns the region id for s if s is a valid 2-letter region code
-// or unknownRegion.
-func getRegionID(s []byte) (regionID, error) {
-	if len(s) == 3 {
-		if isAlpha(s[0]) {
-			return getRegionISO3(s)
-		}
-		if i, err := strconv.ParseUint(string(s), 10, 10); err == nil {
-			return getRegionM49(int(i))
-		}
-	}
-	return getRegionISO2(s)
-}
-
-// getRegionISO2 returns the regionID for the given 2-letter ISO country code
-// or unknownRegion if this does not exist.
-func getRegionISO2(s []byte) (regionID, error) {
-	i, err := findIndex(regionISO, s, "ZZ")
-	if err != nil {
-		return 0, err
-	}
-	return regionID(i) + isoRegionOffset, nil
-}
-
-// getRegionISO3 returns the regionID for the given 3-letter ISO country code
-// or unknownRegion if this does not exist.
-func getRegionISO3(s []byte) (regionID, error) {
-	if tag.FixCase("ZZZ", s) {
-		for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
-			if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
-				return regionID(i) + isoRegionOffset, nil
-			}
-		}
-		for i := 0; i < len(altRegionISO3); i += 3 {
-			if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
-				return regionID(altRegionIDs[i/3]), nil
-			}
-		}
-		return 0, mkErrInvalid(s)
-	}
-	return 0, errSyntax
-}
-
-func getRegionM49(n int) (regionID, error) {
-	if 0 < n && n <= 999 {
-		const (
-			searchBits = 7
-			regionBits = 9
-			regionMask = 1<<regionBits - 1
-		)
-		idx := n >> searchBits
-		buf := fromM49[m49Index[idx]:m49Index[idx+1]]
-		val := uint16(n) << regionBits // we rely on bits shifting out
-		i := sort.Search(len(buf), func(i int) bool {
-			return buf[i] >= val
-		})
-		if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
-			return regionID(r & regionMask), nil
-		}
-	}
-	var e ValueError
-	fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n)
-	return 0, e
-}
-
-// normRegion returns a region if r is deprecated or 0 otherwise.
-// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
-// TODO: consider mapping split up regions to new most populous one (like CLDR).
-func normRegion(r regionID) regionID {
-	m := regionOldMap
-	k := sort.Search(len(m), func(i int) bool {
-		return m[i].from >= uint16(r)
-	})
-	if k < len(m) && m[k].from == uint16(r) {
-		return regionID(m[k].to)
-	}
-	return 0
-}
-
-const (
-	iso3166UserAssigned = 1 << iota
-	ccTLD
-	bcp47Region
-)
-
-func (r regionID) typ() byte {
-	return regionTypes[r]
-}
-
-// String returns the BCP 47 representation for the region.
-// It returns "ZZ" for an unspecified region.
-func (r regionID) String() string {
-	if r < isoRegionOffset {
-		if r == 0 {
-			return "ZZ"
-		}
-		return fmt.Sprintf("%03d", r.M49())
-	}
-	r -= isoRegionOffset
-	return regionISO.Elem(int(r))[:2]
-}
-
-// ISO3 returns the 3-letter ISO code of r.
-// Note that not all regions have a 3-letter ISO code.
-// In such cases this method returns "ZZZ".
-func (r regionID) ISO3() string {
-	if r < isoRegionOffset {
-		return "ZZZ"
-	}
-	r -= isoRegionOffset
-	reg := regionISO.Elem(int(r))
-	switch reg[2] {
-	case 0:
-		return altRegionISO3[reg[3]:][:3]
-	case ' ':
-		return "ZZZ"
-	}
-	return reg[0:1] + reg[2:4]
-}
-
-// M49 returns the UN M.49 encoding of r, or 0 if this encoding
-// is not defined for r.
-func (r regionID) M49() int {
-	return int(m49[r])
-}
-
-// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
-// may include private-use tags that are assigned by CLDR and used in this
-// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
-func (r regionID) IsPrivateUse() bool {
-	return r.typ()&iso3166UserAssigned != 0
-}
-
-type scriptID uint8
-
-// getScriptID returns the script id for string s. It assumes that s
-// is of the format [A-Z][a-z]{3}.
-func getScriptID(idx tag.Index, s []byte) (scriptID, error) {
-	i, err := findIndex(idx, s, "Zzzz")
-	return scriptID(i), err
-}
-
-// String returns the script code in title case.
-// It returns "Zzzz" for an unspecified script.
-func (s scriptID) String() string {
-	if s == 0 {
-		return "Zzzz"
-	}
-	return script.Elem(int(s))
-}
-
-// IsPrivateUse reports whether this script code is reserved for private use.
-func (s scriptID) IsPrivateUse() bool {
-	return _Qaaa <= s && s <= _Qabx
-}
-
-const (
-	maxAltTaglen = len("en-US-POSIX")
-	maxLen       = maxAltTaglen
-)
-
-var (
-	// grandfatheredMap holds a mapping from legacy and grandfathered tags to
-	// their base language or index to more elaborate tag.
-	grandfatheredMap = map[[maxLen]byte]int16{
-		[maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban
-		[maxLen]byte{'i', '-', 'a', 'm', 'i'}:                          _ami, // i-ami
-		[maxLen]byte{'i', '-', 'b', 'n', 'n'}:                          _bnn, // i-bnn
-		[maxLen]byte{'i', '-', 'h', 'a', 'k'}:                          _hak, // i-hak
-		[maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}:      _tlh, // i-klingon
-		[maxLen]byte{'i', '-', 'l', 'u', 'x'}:                          _lb,  // i-lux
-		[maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}:           _nv,  // i-navajo
-		[maxLen]byte{'i', '-', 'p', 'w', 'n'}:                          _pwn, // i-pwn
-		[maxLen]byte{'i', '-', 't', 'a', 'o'}:                          _tao, // i-tao
-		[maxLen]byte{'i', '-', 't', 'a', 'y'}:                          _tay, // i-tay
-		[maxLen]byte{'i', '-', 't', 's', 'u'}:                          _tsu, // i-tsu
-		[maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}:                     _nb,  // no-bok
-		[maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}:                     _nn,  // no-nyn
-		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}:      _sfb, // sgn-BE-FR
-		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}:      _vgt, // sgn-BE-NL
-		[maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}:      _sgg, // sgn-CH-DE
-		[maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}:           _cmn, // zh-guoyu
-		[maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}:           _hak, // zh-hakka
-		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan
-		[maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}:           _hsn, // zh-xiang
-
-		// Grandfathered tags with no modern replacement will be converted as
-		// follows:
-		[maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish
-		[maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}:           -2, // en-GB-oed
-		[maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}:           -3, // i-default
-		[maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}:      -4, // i-enochian
-		[maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}:                     -5, // i-mingo
-		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}:                          -6, // zh-min
-
-		// CLDR-specific tag.
-		[maxLen]byte{'r', 'o', 'o', 't'}:                                    0,  // root
-		[maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX"
-	}
-
-	altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102}
-
-	altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix"
-)
-
-func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
-	if v, ok := grandfatheredMap[s]; ok {
-		if v < 0 {
-			return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
-		}
-		t.lang = langID(v)
-		return t, true
-	}
-	return t, false
-}
+type scriptID = language.Script
diff --git a/language/lookup_test.go b/language/lookup_test.go
deleted file mode 100644
index 9833830..0000000
--- a/language/lookup_test.go
+++ /dev/null
@@ -1,457 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
-	"testing"
-
-	"golang.org/x/text/internal/tag"
-)
-
-func b(s string) []byte {
-	return []byte(s)
-}
-
-func TestLangID(t *testing.T) {
-	tests := []struct {
-		id, bcp47, iso3, norm string
-		err                   error
-	}{
-		{id: "", bcp47: "und", iso3: "und", err: errSyntax},
-		{id: "  ", bcp47: "und", iso3: "und", err: errSyntax},
-		{id: "   ", bcp47: "und", iso3: "und", err: errSyntax},
-		{id: "    ", bcp47: "und", iso3: "und", err: errSyntax},
-		{id: "xxx", bcp47: "und", iso3: "und", err: mkErrInvalid([]byte("xxx"))},
-		{id: "und", bcp47: "und", iso3: "und"},
-		{id: "aju", bcp47: "aju", iso3: "aju", norm: "jrb"},
-		{id: "jrb", bcp47: "jrb", iso3: "jrb"},
-		{id: "es", bcp47: "es", iso3: "spa"},
-		{id: "spa", bcp47: "es", iso3: "spa"},
-		{id: "ji", bcp47: "ji", iso3: "yid-", norm: "yi"},
-		{id: "jw", bcp47: "jw", iso3: "jav-", norm: "jv"},
-		{id: "ar", bcp47: "ar", iso3: "ara"},
-		{id: "kw", bcp47: "kw", iso3: "cor"},
-		{id: "arb", bcp47: "arb", iso3: "arb", norm: "ar"},
-		{id: "ar", bcp47: "ar", iso3: "ara"},
-		{id: "kur", bcp47: "ku", iso3: "kur"},
-		{id: "nl", bcp47: "nl", iso3: "nld"},
-		{id: "NL", bcp47: "nl", iso3: "nld"},
-		{id: "gsw", bcp47: "gsw", iso3: "gsw"},
-		{id: "gSW", bcp47: "gsw", iso3: "gsw"},
-		{id: "und", bcp47: "und", iso3: "und"},
-		{id: "sh", bcp47: "sh", iso3: "hbs", norm: "sr"},
-		{id: "hbs", bcp47: "sh", iso3: "hbs", norm: "sr"},
-		{id: "no", bcp47: "no", iso3: "nor", norm: "no"},
-		{id: "nor", bcp47: "no", iso3: "nor", norm: "no"},
-		{id: "cmn", bcp47: "cmn", iso3: "cmn", norm: "zh"},
-	}
-	for i, tt := range tests {
-		want, err := getLangID(b(tt.id))
-		if err != tt.err {
-			t.Errorf("%d:err(%s): found %q; want %q", i, tt.id, err, tt.err)
-		}
-		if err != nil {
-			continue
-		}
-		if id, _ := getLangISO2(b(tt.bcp47)); len(tt.bcp47) == 2 && want != id {
-			t.Errorf("%d:getISO2(%s): found %v; want %v", i, tt.bcp47, id, want)
-		}
-		if len(tt.iso3) == 3 {
-			if id, _ := getLangISO3(b(tt.iso3)); want != id {
-				t.Errorf("%d:getISO3(%s): found %q; want %q", i, tt.iso3, id, want)
-			}
-			if id, _ := getLangID(b(tt.iso3)); want != id {
-				t.Errorf("%d:getID3(%s): found %v; want %v", i, tt.iso3, id, want)
-			}
-		}
-		norm := want
-		if tt.norm != "" {
-			norm, _ = getLangID(b(tt.norm))
-		}
-		id, _ := normLang(want)
-		if id != norm {
-			t.Errorf("%d:norm(%s): found %v; want %v", i, tt.id, id, norm)
-		}
-		if id := want.String(); tt.bcp47 != id {
-			t.Errorf("%d:String(): found %s; want %s", i, id, tt.bcp47)
-		}
-		if id := want.ISO3(); tt.iso3[:3] != id {
-			t.Errorf("%d:iso3(): found %s; want %s", i, id, tt.iso3[:3])
-		}
-	}
-}
-
-func TestGrandfathered(t *testing.T) {
-	for _, tt := range []struct{ in, out string }{
-		{"art-lojban", "jbo"},
-		{"i-ami", "ami"},
-		{"i-bnn", "bnn"},
-		{"i-hak", "hak"},
-		{"i-klingon", "tlh"},
-		{"i-lux", "lb"},
-		{"i-navajo", "nv"},
-		{"i-pwn", "pwn"},
-		{"i-tao", "tao"},
-		{"i-tay", "tay"},
-		{"i-tsu", "tsu"},
-		{"no-bok", "nb"},
-		{"no-nyn", "nn"},
-		{"sgn-BE-FR", "sfb"},
-		{"sgn-BE-NL", "vgt"},
-		{"sgn-CH-DE", "sgg"},
-		{"sgn-ch-de", "sgg"},
-		{"zh-guoyu", "cmn"},
-		{"zh-hakka", "hak"},
-		{"zh-min-nan", "nan"},
-		{"zh-xiang", "hsn"},
-
-		// Grandfathered tags with no modern replacement will be converted as follows:
-		{"cel-gaulish", "xtg-x-cel-gaulish"},
-		{"en-GB-oed", "en-GB-oxendict"},
-		{"en-gb-oed", "en-GB-oxendict"},
-		{"i-default", "en-x-i-default"},
-		{"i-enochian", "und-x-i-enochian"},
-		{"i-mingo", "see-x-i-mingo"},
-		{"zh-min", "nan-x-zh-min"},
-
-		{"root", "und"},
-		{"en_US_POSIX", "en-US-u-va-posix"},
-		{"en_us_posix", "en-US-u-va-posix"},
-		{"en-us-posix", "en-US-u-va-posix"},
-	} {
-		got := Raw.Make(tt.in)
-		want := Raw.MustParse(tt.out)
-		if got != want {
-			t.Errorf("%s: got %q; want %q", tt.in, got, want)
-		}
-	}
-}
-
-func TestRegionID(t *testing.T) {
-	tests := []struct {
-		in, out string
-	}{
-		{"_  ", ""},
-		{"_000", ""},
-		{"419", "419"},
-		{"AA", "AA"},
-		{"ATF", "TF"},
-		{"HV", "HV"},
-		{"CT", "CT"},
-		{"DY", "DY"},
-		{"IC", "IC"},
-		{"FQ", "FQ"},
-		{"JT", "JT"},
-		{"ZZ", "ZZ"},
-		{"EU", "EU"},
-		{"QO", "QO"},
-		{"FX", "FX"},
-	}
-	for i, tt := range tests {
-		if tt.in[0] == '_' {
-			id := tt.in[1:]
-			if _, err := getRegionID(b(id)); err == nil {
-				t.Errorf("%d:err(%s): found nil; want error", i, id)
-			}
-			continue
-		}
-		want, _ := getRegionID(b(tt.in))
-		if s := want.String(); s != tt.out {
-			t.Errorf("%d:%s: found %q; want %q", i, tt.in, s, tt.out)
-		}
-		if len(tt.in) == 2 {
-			want, _ := getRegionISO2(b(tt.in))
-			if s := want.String(); s != tt.out {
-				t.Errorf("%d:getISO2(%s): found %q; want %q", i, tt.in, s, tt.out)
-			}
-		}
-	}
-}
-
-func TestRegionType(t *testing.T) {
-	for _, tt := range []struct {
-		r string
-		t byte
-	}{
-		{"NL", bcp47Region | ccTLD},
-		{"EU", bcp47Region | ccTLD}, // exceptionally reserved
-		{"AN", bcp47Region | ccTLD}, // transitionally reserved
-
-		{"DD", bcp47Region}, // deleted in ISO, deprecated in BCP 47
-		{"NT", bcp47Region}, // transitionally reserved, deprecated in BCP 47
-
-		{"XA", iso3166UserAssigned | bcp47Region},
-		{"ZZ", iso3166UserAssigned | bcp47Region},
-		{"AA", iso3166UserAssigned | bcp47Region},
-		{"QO", iso3166UserAssigned | bcp47Region},
-		{"QM", iso3166UserAssigned | bcp47Region},
-		{"XK", iso3166UserAssigned | bcp47Region},
-
-		{"CT", 0}, // deleted in ISO, not in BCP 47, canonicalized in CLDR
-	} {
-		r := MustParseRegion(tt.r)
-		if tp := r.typ(); tp != tt.t {
-			t.Errorf("Type(%s): got %x; want %x", tt.r, tp, tt.t)
-		}
-	}
-}
-
-func TestRegionISO3(t *testing.T) {
-	tests := []struct {
-		from, iso3, to string
-	}{
-		{"  ", "ZZZ", "ZZ"},
-		{"000", "ZZZ", "ZZ"},
-		{"AA", "AAA", ""},
-		{"CT", "CTE", ""},
-		{"DY", "DHY", ""},
-		{"EU", "QUU", ""},
-		{"HV", "HVO", ""},
-		{"IC", "ZZZ", "ZZ"},
-		{"JT", "JTN", ""},
-		{"PZ", "PCZ", ""},
-		{"QU", "QUU", "EU"},
-		{"QO", "QOO", ""},
-		{"YD", "YMD", ""},
-		{"FQ", "ATF", "TF"},
-		{"TF", "ATF", ""},
-		{"FX", "FXX", ""},
-		{"ZZ", "ZZZ", ""},
-		{"419", "ZZZ", "ZZ"},
-	}
-	for _, tt := range tests {
-		r, _ := getRegionID(b(tt.from))
-		if s := r.ISO3(); s != tt.iso3 {
-			t.Errorf("iso3(%q): found %q; want %q", tt.from, s, tt.iso3)
-		}
-		if tt.iso3 == "" {
-			continue
-		}
-		want := tt.to
-		if tt.to == "" {
-			want = tt.from
-		}
-		r, _ = getRegionID(b(want))
-		if id, _ := getRegionISO3(b(tt.iso3)); id != r {
-			t.Errorf("%s: found %q; want %q", tt.iso3, id, want)
-		}
-	}
-}
-
-func TestRegionM49(t *testing.T) {
-	fromTests := []struct {
-		m49 int
-		id  string
-	}{
-		{0, ""},
-		{-1, ""},
-		{1000, ""},
-		{10000, ""},
-
-		{001, "001"},
-		{104, "MM"},
-		{180, "CD"},
-		{230, "ET"},
-		{231, "ET"},
-		{249, "FX"},
-		{250, "FR"},
-		{276, "DE"},
-		{278, "DD"},
-		{280, "DE"},
-		{419, "419"},
-		{626, "TL"},
-		{736, "SD"},
-		{840, "US"},
-		{854, "BF"},
-		{891, "CS"},
-		{899, ""},
-		{958, "AA"},
-		{966, "QT"},
-		{967, "EU"},
-		{999, "ZZ"},
-	}
-	for _, tt := range fromTests {
-		id, err := getRegionM49(tt.m49)
-		if want, have := err != nil, tt.id == ""; want != have {
-			t.Errorf("error(%d): have %v; want %v", tt.m49, have, want)
-			continue
-		}
-		r, _ := getRegionID(b(tt.id))
-		if r != id {
-			t.Errorf("region(%d): have %s; want %s", tt.m49, id, r)
-		}
-	}
-
-	toTests := []struct {
-		m49 int
-		id  string
-	}{
-		{0, "000"},
-		{0, "IC"}, // Some codes don't have an ID
-
-		{001, "001"},
-		{104, "MM"},
-		{104, "BU"},
-		{180, "CD"},
-		{180, "ZR"},
-		{231, "ET"},
-		{250, "FR"},
-		{249, "FX"},
-		{276, "DE"},
-		{278, "DD"},
-		{419, "419"},
-		{626, "TL"},
-		{626, "TP"},
-		{729, "SD"},
-		{826, "GB"},
-		{840, "US"},
-		{854, "BF"},
-		{891, "YU"},
-		{891, "CS"},
-		{958, "AA"},
-		{966, "QT"},
-		{967, "EU"},
-		{967, "QU"},
-		{999, "ZZ"},
-		// For codes that don't have an M49 code use the replacement value,
-		// if available.
-		{854, "HV"}, // maps to Burkino Faso
-	}
-	for _, tt := range toTests {
-		r, _ := getRegionID(b(tt.id))
-		if r.M49() != tt.m49 {
-			t.Errorf("m49(%q): have %d; want %d", tt.id, r.M49(), tt.m49)
-		}
-	}
-}
-
-func TestRegionDeprecation(t *testing.T) {
-	tests := []struct{ in, out string }{
-		{"BU", "MM"},
-		{"BUR", "MM"},
-		{"CT", "KI"},
-		{"DD", "DE"},
-		{"DDR", "DE"},
-		{"DY", "BJ"},
-		{"FX", "FR"},
-		{"HV", "BF"},
-		{"JT", "UM"},
-		{"MI", "UM"},
-		{"NH", "VU"},
-		{"NQ", "AQ"},
-		{"PU", "UM"},
-		{"PZ", "PA"},
-		{"QU", "EU"},
-		{"RH", "ZW"},
-		{"TP", "TL"},
-		{"UK", "GB"},
-		{"VD", "VN"},
-		{"WK", "UM"},
-		{"YD", "YE"},
-		{"NL", "NL"},
-	}
-	for _, tt := range tests {
-		rIn, _ := getRegionID([]byte(tt.in))
-		rOut, _ := getRegionISO2([]byte(tt.out))
-		r := normRegion(rIn)
-		if rOut == rIn && r != 0 {
-			t.Errorf("%s: was %q; want %q", tt.in, r, tt.in)
-		}
-		if rOut != rIn && r != rOut {
-			t.Errorf("%s: was %q; want %q", tt.in, r, tt.out)
-		}
-
-	}
-}
-
-func TestGetScriptID(t *testing.T) {
-	idx := tag.Index("0000BbbbDdddEeeeZzzz\xff\xff\xff\xff")
-	tests := []struct {
-		in  string
-		out scriptID
-	}{
-		{"    ", 0},
-		{"      ", 0},
-		{"  ", 0},
-		{"", 0},
-		{"Aaaa", 0},
-		{"Bbbb", 1},
-		{"Dddd", 2},
-		{"dddd", 2},
-		{"dDDD", 2},
-		{"Eeee", 3},
-		{"Zzzz", 4},
-	}
-	for i, tt := range tests {
-		if id, err := getScriptID(idx, b(tt.in)); id != tt.out {
-			t.Errorf("%d:%s: found %d; want %d", i, tt.in, id, tt.out)
-		} else if id == 0 && err == nil {
-			t.Errorf("%d:%s: no error; expected one", i, tt.in)
-		}
-	}
-}
-
-func TestIsPrivateUse(t *testing.T) {
-	type test struct {
-		s       string
-		private bool
-	}
-	tests := []test{
-		{"en", false},
-		{"und", false},
-		{"pzn", false},
-		{"qaa", true},
-		{"qtz", true},
-		{"qua", false},
-	}
-	for i, tt := range tests {
-		x, _ := getLangID([]byte(tt.s))
-		if b := x.IsPrivateUse(); b != tt.private {
-			t.Errorf("%d: langID.IsPrivateUse(%s) was %v; want %v", i, tt.s, b, tt.private)
-		}
-	}
-	tests = []test{
-		{"001", false},
-		{"419", false},
-		{"899", false},
-		{"900", false},
-		{"957", false},
-		{"958", true},
-		{"AA", true},
-		{"AC", false},
-		{"EU", false}, // CLDR grouping, exceptionally reserved in ISO.
-		{"QU", true},  // Canonicalizes to EU, User-assigned in ISO.
-		{"QO", true},  // CLDR grouping, User-assigned in ISO.
-		{"QA", false},
-		{"QM", true},
-		{"QZ", true},
-		{"XA", true},
-		{"XK", true}, // Assigned to Kosovo in CLDR, User-assigned in ISO.
-		{"XZ", true},
-		{"ZW", false},
-		{"ZZ", true},
-	}
-	for i, tt := range tests {
-		x, _ := getRegionID([]byte(tt.s))
-		if b := x.IsPrivateUse(); b != tt.private {
-			t.Errorf("%d: regionID.IsPrivateUse(%s) was %v; want %v", i, tt.s, b, tt.private)
-		}
-	}
-	tests = []test{
-		{"Latn", false},
-		{"Laaa", false}, // invalid
-		{"Qaaa", true},
-		{"Qabx", true},
-		{"Qaby", false},
-		{"Zyyy", false},
-		{"Zzzz", false},
-	}
-	for i, tt := range tests {
-		x, _ := getScriptID(script, []byte(tt.s))
-		if b := x.IsPrivateUse(); b != tt.private {
-			t.Errorf("%d: scriptID.IsPrivateUse(%s) was %v; want %v", i, tt.s, b, tt.private)
-		}
-	}
-}
diff --git a/language/match.go b/language/match.go
index 15b74d1..33dd657 100644
--- a/language/match.go
+++ b/language/match.go
@@ -4,7 +4,11 @@
 
 package language
 
-import "errors"
+import (
+	"errors"
+
+	"golang.org/x/text/language/internal"
+)
 
 // A MatchOption configures a Matcher.
 type MatchOption func(*matcher)
@@ -74,12 +78,13 @@
 }
 
 func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) {
+	var tt language.Tag
 	match, w, c := m.getBest(want...)
 	if match != nil {
-		t, index = match.tag, match.index
+		tt, index = match.tag, match.index
 	} else {
 		// TODO: this should be an option
-		t = m.default_.tag
+		tt = m.default_.tag
 		if m.preferSameScript {
 		outer:
 			for _, w := range want {
@@ -91,7 +96,7 @@
 				}
 				for i, h := range m.supported {
 					if script.scriptID == h.maxScript {
-						t, index = h.tag, i
+						tt, index = h.tag, i
 						break outer
 					}
 				}
@@ -99,232 +104,35 @@
 		}
 		// TODO: select first language tag based on script.
 	}
-	if w.region != 0 && t.region != 0 && t.region.contains(w.region) {
-		t, _ = Raw.Compose(t, Region{w.region})
+	if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) {
+		t, _ := Raw.Compose(Tag{tt}, Region{w.RegionID})
+		tt = t.tag
 	}
 	// Copy options from the user-provided tag into the result tag. This is hard
 	// to do after the fact, so we do it here.
 	// TODO: add in alternative variants to -u-va-.
 	// TODO: add preferred region to -u-rg-.
 	if e := w.Extensions(); len(e) > 0 {
-		t, _ = Raw.Compose(t, e)
+		// TODO: improve performance.
+		ext := make([]Extension, len(e))
+		for _, ee := range e {
+			ext = append(ext, Extension{ee})
+		}
+		t, _ := Raw.Compose(Tag{tt}, ext)
+		tt = t.tag
 	}
-	return t, index, c
-}
-
-type scriptRegionFlags uint8
-
-const (
-	isList = 1 << iota
-	scriptInFrom
-	regionInFrom
-)
-
-func (t *Tag) setUndefinedLang(id langID) {
-	if t.lang == 0 {
-		t.lang = id
-	}
-}
-
-func (t *Tag) setUndefinedScript(id scriptID) {
-	if t.script == 0 {
-		t.script = id
-	}
-}
-
-func (t *Tag) setUndefinedRegion(id regionID) {
-	if t.region == 0 || t.region.contains(id) {
-		t.region = id
-	}
+	return Tag{tt}, index, c
 }
 
 // ErrMissingLikelyTagsData indicates no information was available
 // to compute likely values of missing tags.
 var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
 
-// addLikelySubtags sets subtags to their most likely value, given the locale.
-// In most cases this means setting fields for unknown values, but in some
-// cases it may alter a value.  It returns an ErrMissingLikelyTagsData error
-// if the given locale cannot be expanded.
-func (t Tag) addLikelySubtags() (Tag, error) {
-	id, err := addTags(t)
-	if err != nil {
-		return t, err
-	} else if id.equalTags(t) {
-		return t, nil
-	}
-	id.remakeString()
-	return id, nil
-}
-
-// specializeRegion attempts to specialize a group region.
-func specializeRegion(t *Tag) bool {
-	if i := regionInclusion[t.region]; i < nRegionGroups {
-		x := likelyRegionGroup[i]
-		if langID(x.lang) == t.lang && scriptID(x.script) == t.script {
-			t.region = regionID(x.region)
-		}
-		return true
-	}
-	return false
-}
-
-func addTags(t Tag) (Tag, error) {
-	// We leave private use identifiers alone.
-	if t.private() {
-		return t, nil
-	}
-	if t.script != 0 && t.region != 0 {
-		if t.lang != 0 {
-			// already fully specified
-			specializeRegion(&t)
-			return t, nil
-		}
-		// Search matches for und-script-region. Note that for these cases
-		// region will never be a group so there is no need to check for this.
-		list := likelyRegion[t.region : t.region+1]
-		if x := list[0]; x.flags&isList != 0 {
-			list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
-		}
-		for _, x := range list {
-			// Deviating from the spec. See match_test.go for details.
-			if scriptID(x.script) == t.script {
-				t.setUndefinedLang(langID(x.lang))
-				return t, nil
-			}
-		}
-	}
-	if t.lang != 0 {
-		// Search matches for lang-script and lang-region, where lang != und.
-		if t.lang < langNoIndexOffset {
-			x := likelyLang[t.lang]
-			if x.flags&isList != 0 {
-				list := likelyLangList[x.region : x.region+uint16(x.script)]
-				if t.script != 0 {
-					for _, x := range list {
-						if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 {
-							t.setUndefinedRegion(regionID(x.region))
-							return t, nil
-						}
-					}
-				} else if t.region != 0 {
-					count := 0
-					goodScript := true
-					tt := t
-					for _, x := range list {
-						// We visit all entries for which the script was not
-						// defined, including the ones where the region was not
-						// defined. This allows for proper disambiguation within
-						// regions.
-						if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) {
-							tt.region = regionID(x.region)
-							tt.setUndefinedScript(scriptID(x.script))
-							goodScript = goodScript && tt.script == scriptID(x.script)
-							count++
-						}
-					}
-					if count == 1 {
-						return tt, nil
-					}
-					// Even if we fail to find a unique Region, we might have
-					// an unambiguous script.
-					if goodScript {
-						t.script = tt.script
-					}
-				}
-			}
-		}
-	} else {
-		// Search matches for und-script.
-		if t.script != 0 {
-			x := likelyScript[t.script]
-			if x.region != 0 {
-				t.setUndefinedRegion(regionID(x.region))
-				t.setUndefinedLang(langID(x.lang))
-				return t, nil
-			}
-		}
-		// Search matches for und-region. If und-script-region exists, it would
-		// have been found earlier.
-		if t.region != 0 {
-			if i := regionInclusion[t.region]; i < nRegionGroups {
-				x := likelyRegionGroup[i]
-				if x.region != 0 {
-					t.setUndefinedLang(langID(x.lang))
-					t.setUndefinedScript(scriptID(x.script))
-					t.region = regionID(x.region)
-				}
-			} else {
-				x := likelyRegion[t.region]
-				if x.flags&isList != 0 {
-					x = likelyRegionList[x.lang]
-				}
-				if x.script != 0 && x.flags != scriptInFrom {
-					t.setUndefinedLang(langID(x.lang))
-					t.setUndefinedScript(scriptID(x.script))
-					return t, nil
-				}
-			}
-		}
-	}
-
-	// Search matches for lang.
-	if t.lang < langNoIndexOffset {
-		x := likelyLang[t.lang]
-		if x.flags&isList != 0 {
-			x = likelyLangList[x.region]
-		}
-		if x.region != 0 {
-			t.setUndefinedScript(scriptID(x.script))
-			t.setUndefinedRegion(regionID(x.region))
-		}
-		specializeRegion(&t)
-		if t.lang == 0 {
-			t.lang = _en // default language
-		}
-		return t, nil
-	}
-	return t, ErrMissingLikelyTagsData
-}
-
-func (t *Tag) setTagsFrom(id Tag) {
-	t.lang = id.lang
-	t.script = id.script
-	t.region = id.region
-}
-
-// minimize removes the region or script subtags from t such that
-// t.addLikelySubtags() == t.minimize().addLikelySubtags().
-func (t Tag) minimize() (Tag, error) {
-	t, err := minimizeTags(t)
-	if err != nil {
-		return t, err
-	}
-	t.remakeString()
-	return t, nil
-}
-
-// minimizeTags mimics the behavior of the ICU 51 C implementation.
-func minimizeTags(t Tag) (Tag, error) {
-	if t.equalTags(und) {
-		return t, nil
-	}
-	max, err := addTags(t)
-	if err != nil {
-		return t, err
-	}
-	for _, id := range [...]Tag{
-		{lang: t.lang},
-		{lang: t.lang, region: t.region},
-		{lang: t.lang, script: t.script},
-	} {
-		if x, err := addTags(id); err == nil && max.equalTags(x) {
-			t.setTagsFrom(id)
-			break
-		}
-	}
-	return t, nil
-}
+// func (t *Tag) setTagsFrom(id Tag) {
+// 	t.LangID = id.LangID
+// 	t.ScriptID = id.ScriptID
+// 	t.RegionID = id.RegionID
+// }
 
 // Tag Matching
 // CLDR defines an algorithm for finding the best match between two sets of language
@@ -456,7 +264,7 @@
 // haveTag holds a supported Tag and its maximized script and region. The maximized
 // or canonicalized language is not stored as it is not needed during matching.
 type haveTag struct {
-	tag Tag
+	tag language.Tag
 
 	// index of this tag in the original list of supported tags.
 	index int
@@ -478,14 +286,14 @@
 	nextMax uint16
 }
 
-func makeHaveTag(tag Tag, index int) (haveTag, langID) {
+func makeHaveTag(tag language.Tag, index int) (haveTag, langID) {
 	max := tag
-	if tag.lang != 0 || tag.region != 0 || tag.script != 0 {
-		max, _ = max.canonicalize(All)
-		max, _ = addTags(max)
-		max.remakeString()
+	if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 {
+		max, _ = canonicalize(All, max)
+		max, _ = max.Maximize()
+		max.RemakeString()
 	}
-	return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang
+	return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID
 }
 
 // altScript returns an alternative script that may match the given script with
@@ -508,7 +316,7 @@
 	h.original = h.original || exact
 	// Don't add new exact matches.
 	for _, v := range h.haveTags {
-		if v.tag.equalsRest(n.tag) {
+		if equalsRest(v.tag, n.tag) {
 			return
 		}
 	}
@@ -517,7 +325,7 @@
 	for i, v := range h.haveTags {
 		if v.maxScript == n.maxScript &&
 			v.maxRegion == n.maxRegion &&
-			v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() {
+			v.tag.VariantOrPrivateTagStr() == n.tag.VariantOrPrivateTagStr() {
 			for h.haveTags[i].nextMax != 0 {
 				i = int(h.haveTags[i].nextMax)
 			}
@@ -530,7 +338,7 @@
 
 // header returns the matchHeader for the given language. It creates one if
 // it doesn't already exist.
-func (m *matcher) header(l langID) *matchHeader {
+func (m *matcher) header(l language.Language) *matchHeader {
 	if h := m.index[l]; h != nil {
 		return h
 	}
@@ -567,16 +375,16 @@
 	// Add supported languages to the index. Add exact matches first to give
 	// them precedence.
 	for i, tag := range supported {
-		pair, _ := makeHaveTag(tag, i)
-		m.header(tag.lang).addIfNew(pair, true)
+		pair, _ := makeHaveTag(tag.tag, i)
+		m.header(tag.tag.LangID).addIfNew(pair, true)
 		m.supported = append(m.supported, &pair)
 	}
-	m.default_ = m.header(supported[0].lang).haveTags[0]
+	m.default_ = m.header(supported[0].tag.LangID).haveTags[0]
 	// Keep these in two different loops to support the case that two equivalent
 	// languages are distinguished, such as iw and he.
 	for i, tag := range supported {
-		pair, max := makeHaveTag(tag, i)
-		if max != tag.lang {
+		pair, max := makeHaveTag(tag.tag, i)
+		if max != tag.tag.LangID {
 			m.header(max).addIfNew(pair, true)
 		}
 	}
@@ -618,66 +426,67 @@
 	// First we match deprecated equivalents. If they are perfect equivalents
 	// (their canonicalization simply substitutes a different language code, but
 	// nothing else), the match confidence is Exact, otherwise it is High.
-	for i, lm := range langAliasMap {
+	for i, lm := range language.AliasMap {
 		// If deprecated codes match and there is no fiddling with the script or
 		// or region, we consider it an exact match.
 		conf := Exact
-		if langAliasTypes[i] != langMacro {
-			if !isExactEquivalent(langID(lm.from)) {
+		if language.AliasTypes[i] != language.Macro {
+			if !isExactEquivalent(langID(lm.From)) {
 				conf = High
 			}
-			update(lm.to, lm.from, conf)
+			update(lm.To, lm.From, conf)
 		}
-		update(lm.from, lm.to, conf)
+		update(lm.From, lm.To, conf)
 	}
 	return m
 }
 
 // getBest gets the best matching tag in m for any of the given tags, taking into
 // account the order of preference of the given tags.
-func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) {
+func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) {
 	best := bestMatch{}
-	for i, w := range want {
-		var max Tag
+	for i, ww := range want {
+		w := ww.tag
+		var max language.Tag
 		// Check for exact match first.
-		h := m.index[w.lang]
-		if w.lang != 0 {
+		h := m.index[w.LangID]
+		if w.LangID != 0 {
 			if h == nil {
 				continue
 			}
 			// Base language is defined.
-			max, _ = w.canonicalize(Legacy | Deprecated | Macro)
+			max, _ = canonicalize(Legacy|Deprecated|Macro, w)
 			// A region that is added through canonicalization is stronger than
 			// a maximized region: set it in the original (e.g. mo -> ro-MD).
-			if w.region != max.region {
-				w.region = max.region
+			if w.RegionID != max.RegionID {
+				w.RegionID = max.RegionID
 			}
 			// TODO: should we do the same for scripts?
 			// See test case: en, sr, nl ; sh ; sr
-			max, _ = addTags(max)
+			max, _ = max.Maximize()
 		} else {
 			// Base language is not defined.
 			if h != nil {
 				for i := range h.haveTags {
 					have := h.haveTags[i]
-					if have.tag.equalsRest(w) {
+					if equalsRest(have.tag, w) {
 						return have, w, Exact
 					}
 				}
 			}
-			if w.script == 0 && w.region == 0 {
+			if w.ScriptID == 0 && w.RegionID == 0 {
 				// We skip all tags matching und for approximate matching, including
 				// private tags.
 				continue
 			}
-			max, _ = addTags(w)
-			if h = m.index[max.lang]; h == nil {
+			max, _ = w.Maximize()
+			if h = m.index[max.LangID]; h == nil {
 				continue
 			}
 		}
 		pin := true
 		for _, t := range want[i+1:] {
-			if w.lang == t.lang {
+			if w.LangID == t.tag.LangID {
 				pin = false
 				break
 			}
@@ -685,11 +494,11 @@
 		// Check for match based on maximized tag.
 		for i := range h.haveTags {
 			have := h.haveTags[i]
-			best.update(have, w, max.script, max.region, pin)
+			best.update(have, w, max.ScriptID, max.RegionID, pin)
 			if best.conf == Exact {
 				for have.nextMax != 0 {
 					have = h.haveTags[have.nextMax]
-					best.update(have, w, max.script, max.region, pin)
+					best.update(have, w, max.ScriptID, max.RegionID, pin)
 				}
 				return best.have, best.want, best.conf
 			}
@@ -697,9 +506,9 @@
 	}
 	if best.conf <= No {
 		if len(want) != 0 {
-			return nil, want[0], No
+			return nil, want[0].tag, No
 		}
-		return nil, Tag{}, No
+		return nil, language.Tag{}, No
 	}
 	return best.have, best.want, best.conf
 }
@@ -707,7 +516,7 @@
 // bestMatch accumulates the best match so far.
 type bestMatch struct {
 	have            *haveTag
-	want            Tag
+	want            language.Tag
 	conf            Confidence
 	pinnedRegion    regionID
 	pinLanguage     bool
@@ -734,19 +543,19 @@
 // still prefer a second language over a dialect of the preferred language by
 // explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should
 // be false.
-func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID, pin bool) {
+func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript scriptID, maxRegion regionID, pin bool) {
 	// Bail if the maximum attainable confidence is below that of the current best match.
 	c := have.conf
 	if c < m.conf {
 		return
 	}
 	// Don't change the language once we already have found an exact match.
-	if m.pinLanguage && tag.lang != m.want.lang {
+	if m.pinLanguage && tag.LangID != m.want.LangID {
 		return
 	}
 	// Pin the region group if we are comparing tags for the same language.
-	if tag.lang == m.want.lang && m.sameRegionGroup {
-		_, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.lang)
+	if tag.LangID == m.want.LangID && m.sameRegionGroup {
+		_, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID)
 		if !sameGroup {
 			return
 		}
@@ -756,7 +565,7 @@
 		// don't pin anything, otherwise pin the language.
 		m.pinLanguage = pin
 	}
-	if have.tag.equalsRest(tag) {
+	if equalsRest(have.tag, tag) {
 	} else if have.maxScript != maxScript {
 		// There is usually very little comprehension between different scripts.
 		// In a few cases there may still be Low comprehension. This possibility
@@ -786,7 +595,7 @@
 
 	// Tie-breaker rules:
 	// We prefer if the pre-maximized language was specified and identical.
-	origLang := have.tag.lang == tag.lang && tag.lang != 0
+	origLang := have.tag.LangID == tag.LangID && tag.LangID != 0
 	if !beaten && m.origLang != origLang {
 		if m.origLang {
 			return
@@ -795,7 +604,7 @@
 	}
 
 	// We prefer if the pre-maximized region was specified and identical.
-	origReg := have.tag.region == tag.region && tag.region != 0
+	origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0
 	if !beaten && m.origReg != origReg {
 		if m.origReg {
 			return
@@ -803,7 +612,7 @@
 		beaten = true
 	}
 
-	regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.lang)
+	regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID)
 	if !beaten && m.regGroupDist != regGroupDist {
 		if regGroupDist > m.regGroupDist {
 			return
@@ -811,7 +620,7 @@
 		beaten = true
 	}
 
-	paradigmReg := isParadigmLocale(tag.lang, have.maxRegion)
+	paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion)
 	if !beaten && m.paradigmReg != paradigmReg {
 		if !paradigmReg {
 			return
@@ -820,7 +629,7 @@
 	}
 
 	// Next we prefer if the pre-maximized script was specified and identical.
-	origScript := have.tag.script == tag.script && tag.script != 0
+	origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0
 	if !beaten && m.origScript != origScript {
 		if m.origScript {
 			return
@@ -876,26 +685,11 @@
 	return defaultDistance, true
 }
 
-func (t Tag) variants() string {
-	if t.pVariant == 0 {
-		return ""
-	}
-	return t.str[t.pVariant:t.pExt]
-}
-
-// variantOrPrivateTagStr returns variants or private use tags.
-func (t Tag) variantOrPrivateTagStr() string {
-	if t.pExt > 0 {
-		return t.str[t.pVariant:t.pExt]
-	}
-	return t.str[t.pVariant:]
-}
-
 // equalsRest compares everything except the language.
-func (a Tag) equalsRest(b Tag) bool {
+func equalsRest(a, b language.Tag) bool {
 	// TODO: don't include extensions in this comparison. To do this efficiently,
 	// though, we should handle private tags separately.
-	return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr()
+	return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateTagStr() == b.VariantOrPrivateTagStr()
 }
 
 // isExactEquivalent returns true if canonicalizing the language will not alter
@@ -914,20 +708,21 @@
 func init() {
 	// Create a list of all languages for which canonicalization may alter the
 	// script or region.
-	for _, lm := range langAliasMap {
-		tag := Tag{lang: langID(lm.from)}
-		if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 {
-			notEquivalent = append(notEquivalent, langID(lm.from))
+	for _, lm := range language.AliasMap {
+		tag := language.Tag{LangID: langID(lm.From)}
+		if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 {
+			notEquivalent = append(notEquivalent, langID(lm.From))
 		}
 	}
 	// Maximize undefined regions of paradigm locales.
 	for i, v := range paradigmLocales {
-		max, _ := addTags(Tag{lang: langID(v[0])})
+		t := language.Tag{LangID: langID(v[0])}
+		max, _ := t.Maximize()
 		if v[1] == 0 {
-			paradigmLocales[i][1] = uint16(max.region)
+			paradigmLocales[i][1] = uint16(max.RegionID)
 		}
 		if v[2] == 0 {
-			paradigmLocales[i][2] = uint16(max.region)
+			paradigmLocales[i][2] = uint16(max.RegionID)
 		}
 	}
 }
diff --git a/language/match_test.go b/language/match_test.go
index 8b60b07..fd36983 100644
--- a/language/match_test.go
+++ b/language/match_test.go
@@ -148,155 +148,6 @@
 	}
 }
 
-func TestAddLikelySubtags(t *testing.T) {
-	tests := []struct{ in, out string }{
-		{"aa", "aa-Latn-ET"},
-		{"aa-Latn", "aa-Latn-ET"},
-		{"aa-Arab", "aa-Arab-ET"},
-		{"aa-Arab-ER", "aa-Arab-ER"},
-		{"kk", "kk-Cyrl-KZ"},
-		{"kk-CN", "kk-Arab-CN"},
-		{"cmn", "cmn"},
-		{"zh-AU", "zh-Hant-AU"},
-		{"zh-VN", "zh-Hant-VN"},
-		{"zh-SG", "zh-Hans-SG"},
-		{"zh-Hant", "zh-Hant-TW"},
-		{"zh-Hani", "zh-Hani-CN"},
-		{"und-Hani", "zh-Hani-CN"},
-		{"und", "en-Latn-US"},
-		{"und-GB", "en-Latn-GB"},
-		{"und-CW", "pap-Latn-CW"},
-		{"und-YT", "fr-Latn-YT"},
-		{"und-Arab", "ar-Arab-EG"},
-		{"und-AM", "hy-Armn-AM"},
-		{"und-TW", "zh-Hant-TW"},
-		{"und-002", "en-Latn-NG"},
-		{"und-Latn-002", "en-Latn-NG"},
-		{"en-Latn-002", "en-Latn-NG"},
-		{"en-002", "en-Latn-NG"},
-		{"en-001", "en-Latn-US"},
-		{"und-003", "en-Latn-US"},
-		{"und-GB", "en-Latn-GB"},
-		{"Latn-001", "en-Latn-US"},
-		{"en-001", "en-Latn-US"},
-		{"es-419", "es-Latn-419"},
-		{"he-145", "he-Hebr-IL"},
-		{"ky-145", "ky-Latn-TR"},
-		{"kk", "kk-Cyrl-KZ"},
-		// Don't specialize duplicate and ambiguous matches.
-		{"kk-034", "kk-Arab-034"}, // Matches IR and AF. Both are Arab.
-		{"ku-145", "ku-Latn-TR"},  // Matches IQ, TR, and LB, but kk -> TR.
-		{"und-Arab-CC", "ms-Arab-CC"},
-		{"und-Arab-GB", "ks-Arab-GB"},
-		{"und-Hans-CC", "zh-Hans-CC"},
-		{"und-CC", "en-Latn-CC"},
-		{"sr", "sr-Cyrl-RS"},
-		{"sr-151", "sr-Latn-151"}, // Matches RO and RU.
-		// We would like addLikelySubtags to generate the same results if the input
-		// only changes by adding tags that would otherwise have been added
-		// by the expansion.
-		// In other words:
-		//     und-AA -> xx-Scrp-AA   implies und-Scrp-AA -> xx-Scrp-AA
-		//     und-AA -> xx-Scrp-AA   implies xx-AA -> xx-Scrp-AA
-		//     und-Scrp -> xx-Scrp-AA implies und-Scrp-AA -> xx-Scrp-AA
-		//     und-Scrp -> xx-Scrp-AA implies xx-Scrp -> xx-Scrp-AA
-		//     xx -> xx-Scrp-AA       implies xx-Scrp -> xx-Scrp-AA
-		//     xx -> xx-Scrp-AA       implies xx-AA -> xx-Scrp-AA
-		//
-		// The algorithm specified in
-		//   http://unicode.org/reports/tr35/tr35-9.html#Supplemental_Data,
-		// Section C.10, does not handle the first case. For example,
-		// the CLDR data contains an entry und-BJ -> fr-Latn-BJ, but not
-		// there is no rule for und-Latn-BJ.  According to spec, und-Latn-BJ
-		// would expand to en-Latn-BJ, violating the aforementioned principle.
-		// We deviate from the spec by letting und-Scrp-AA expand to xx-Scrp-AA
-		// if a rule of the form und-AA -> xx-Scrp-AA is defined.
-		// Note that as of version 23, CLDR has some explicitly specified
-		// entries that do not conform to these rules. The implementation
-		// will not correct these explicit inconsistencies. A later versions of CLDR
-		// is supposed to fix this.
-		{"und-Latn-BJ", "fr-Latn-BJ"},
-		{"und-Bugi-ID", "bug-Bugi-ID"},
-		// regions, scripts and languages without definitions
-		{"und-Arab-AA", "ar-Arab-AA"},
-		{"und-Afak-RE", "fr-Afak-RE"},
-		{"und-Arab-GB", "ks-Arab-GB"},
-		{"abp-Arab-GB", "abp-Arab-GB"},
-		// script has preference over region
-		{"und-Arab-NL", "ar-Arab-NL"},
-		{"zza", "zza-Latn-TR"},
-		// preserve variants and extensions
-		{"de-1901", "de-Latn-DE-1901"},
-		{"de-x-abc", "de-Latn-DE-x-abc"},
-		{"de-1901-x-abc", "de-Latn-DE-1901-x-abc"},
-		{"x-abc", "x-abc"}, // TODO: is this the desired behavior?
-	}
-	for i, tt := range tests {
-		in, _ := Parse(tt.in)
-		out, _ := Parse(tt.out)
-		in, _ = in.addLikelySubtags()
-		if in.String() != out.String() {
-			t.Errorf("%d: add(%s) was %s; want %s", i, tt.in, in, tt.out)
-		}
-	}
-}
-func TestMinimize(t *testing.T) {
-	tests := []struct{ in, out string }{
-		{"aa", "aa"},
-		{"aa-Latn", "aa"},
-		{"aa-Latn-ET", "aa"},
-		{"aa-ET", "aa"},
-		{"aa-Arab", "aa-Arab"},
-		{"aa-Arab-ER", "aa-Arab-ER"},
-		{"aa-Arab-ET", "aa-Arab"},
-		{"und", "und"},
-		{"und-Latn", "und"},
-		{"und-Latn-US", "und"},
-		{"en-Latn-US", "en"},
-		{"cmn", "cmn"},
-		{"cmn-Hans", "cmn-Hans"},
-		{"cmn-Hant", "cmn-Hant"},
-		{"zh-AU", "zh-AU"},
-		{"zh-VN", "zh-VN"},
-		{"zh-SG", "zh-SG"},
-		{"zh-Hant", "zh-Hant"},
-		{"zh-Hant-TW", "zh-TW"},
-		{"zh-Hans", "zh"},
-		{"zh-Hani", "zh-Hani"},
-		{"und-Hans", "und-Hans"},
-		{"und-Hani", "und-Hani"},
-
-		{"und-CW", "und-CW"},
-		{"und-YT", "und-YT"},
-		{"und-Arab", "und-Arab"},
-		{"und-AM", "und-AM"},
-		{"und-Arab-CC", "und-Arab-CC"},
-		{"und-CC", "und-CC"},
-		{"und-Latn-BJ", "und-BJ"},
-		{"und-Bugi-ID", "und-Bugi"},
-		{"bug-Bugi-ID", "bug-Bugi"},
-		// regions, scripts and languages without definitions
-		{"und-Arab-AA", "und-Arab-AA"},
-		// preserve variants and extensions
-		{"de-Latn-1901", "de-1901"},
-		{"de-Latn-x-abc", "de-x-abc"},
-		{"de-DE-1901-x-abc", "de-1901-x-abc"},
-		{"x-abc", "x-abc"}, // TODO: is this the desired behavior?
-	}
-	for i, tt := range tests {
-		in, _ := Parse(tt.in)
-		out, _ := Parse(tt.out)
-		min, _ := in.minimize()
-		if min.String() != out.String() {
-			t.Errorf("%d: min(%s) was %s; want %s", i, tt.in, min, tt.out)
-		}
-		max, _ := min.addLikelySubtags()
-		if x, _ := in.addLikelySubtags(); x.String() != max.String() {
-			t.Errorf("%d: max(min(%s)) = %s; want %s", i, tt.in, max, x)
-		}
-	}
-}
-
 func TestRegionGroups(t *testing.T) {
 	testCases := []struct {
 		a, b     string
@@ -321,7 +172,7 @@
 			t.Errorf("scripts differ: %q vs %q", aScript, bScript)
 			continue
 		}
-		d, _ := regionGroupDist(a.region, b.region, aScript.scriptID, a.lang)
+		d, _ := regionGroupDist(a.tag.RegionID, b.tag.RegionID, aScript.scriptID, a.tag.LangID)
 		if d != tc.distance {
 			t.Errorf("got %q; want %q", d, tc.distance)
 		}
@@ -338,8 +189,8 @@
 		"es-419": true,
 	}
 	for str, want := range testCases {
-		tag := Make(str)
-		got := isParadigmLocale(tag.lang, tag.region)
+		tag := Make(str).tag
+		got := isParadigmLocale(tag.LangID, tag.RegionID)
 		if got != want {
 			t.Errorf("isPL(%q) = %v; want %v", str, got, want)
 		}
diff --git a/language/parse.go b/language/parse.go
index fca2d30..3f0f4ad 100644
--- a/language/parse.go
+++ b/language/parse.go
@@ -5,216 +5,21 @@
 package language
 
 import (
-	"bytes"
 	"errors"
-	"fmt"
-	"sort"
 	"strconv"
 	"strings"
 
-	"golang.org/x/text/internal/tag"
+	"golang.org/x/text/language/internal"
 )
 
-// isAlpha returns true if the byte is not a digit.
-// b must be an ASCII letter or digit.
-func isAlpha(b byte) bool {
-	return b > '9'
-}
-
-// isAlphaNum returns true if the string contains only ASCII letters or digits.
-func isAlphaNum(s []byte) bool {
-	for _, c := range s {
-		if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
-			return false
-		}
-	}
-	return true
-}
-
-// errSyntax is returned by any of the parsing functions when the
-// input is not well-formed, according to BCP 47.
-// TODO: return the position at which the syntax error occurred?
-var errSyntax = errors.New("language: tag is not well-formed")
-
 // ValueError is returned by any of the parsing functions when the
 // input is well-formed but the respective subtag is not recognized
 // as a valid value.
-type ValueError struct {
-	v [8]byte
-}
+type ValueError interface {
+	error
 
-func mkErrInvalid(s []byte) error {
-	var e ValueError
-	copy(e.v[:], s)
-	return e
-}
-
-func (e ValueError) tag() []byte {
-	n := bytes.IndexByte(e.v[:], 0)
-	if n == -1 {
-		n = 8
-	}
-	return e.v[:n]
-}
-
-// Error implements the error interface.
-func (e ValueError) Error() string {
-	return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
-}
-
-// Subtag returns the subtag for which the error occurred.
-func (e ValueError) Subtag() string {
-	return string(e.tag())
-}
-
-// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
-type scanner struct {
-	b     []byte
-	bytes [max99thPercentileSize]byte
-	token []byte
-	start int // start position of the current token
-	end   int // end position of the current token
-	next  int // next point for scan
-	err   error
-	done  bool
-}
-
-func makeScannerString(s string) scanner {
-	scan := scanner{}
-	if len(s) <= len(scan.bytes) {
-		scan.b = scan.bytes[:copy(scan.bytes[:], s)]
-	} else {
-		scan.b = []byte(s)
-	}
-	scan.init()
-	return scan
-}
-
-// makeScanner returns a scanner using b as the input buffer.
-// b is not copied and may be modified by the scanner routines.
-func makeScanner(b []byte) scanner {
-	scan := scanner{b: b}
-	scan.init()
-	return scan
-}
-
-func (s *scanner) init() {
-	for i, c := range s.b {
-		if c == '_' {
-			s.b[i] = '-'
-		}
-	}
-	s.scan()
-}
-
-// restToLower converts the string between start and end to lower case.
-func (s *scanner) toLower(start, end int) {
-	for i := start; i < end; i++ {
-		c := s.b[i]
-		if 'A' <= c && c <= 'Z' {
-			s.b[i] += 'a' - 'A'
-		}
-	}
-}
-
-func (s *scanner) setError(e error) {
-	if s.err == nil || (e == errSyntax && s.err != errSyntax) {
-		s.err = e
-	}
-}
-
-// resizeRange shrinks or grows the array at position oldStart such that
-// a new string of size newSize can fit between oldStart and oldEnd.
-// Sets the scan point to after the resized range.
-func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
-	s.start = oldStart
-	if end := oldStart + newSize; end != oldEnd {
-		diff := end - oldEnd
-		if end < cap(s.b) {
-			b := make([]byte, len(s.b)+diff)
-			copy(b, s.b[:oldStart])
-			copy(b[end:], s.b[oldEnd:])
-			s.b = b
-		} else {
-			s.b = append(s.b[end:], s.b[oldEnd:]...)
-		}
-		s.next = end + (s.next - s.end)
-		s.end = end
-	}
-}
-
-// replace replaces the current token with repl.
-func (s *scanner) replace(repl string) {
-	s.resizeRange(s.start, s.end, len(repl))
-	copy(s.b[s.start:], repl)
-}
-
-// gobble removes the current token from the input.
-// Caller must call scan after calling gobble.
-func (s *scanner) gobble(e error) {
-	s.setError(e)
-	if s.start == 0 {
-		s.b = s.b[:+copy(s.b, s.b[s.next:])]
-		s.end = 0
-	} else {
-		s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
-		s.end = s.start - 1
-	}
-	s.next = s.start
-}
-
-// deleteRange removes the given range from s.b before the current token.
-func (s *scanner) deleteRange(start, end int) {
-	s.setError(errSyntax)
-	s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
-	diff := end - start
-	s.next -= diff
-	s.start -= diff
-	s.end -= diff
-}
-
-// scan parses the next token of a BCP 47 string.  Tokens that are larger
-// than 8 characters or include non-alphanumeric characters result in an error
-// and are gobbled and removed from the output.
-// It returns the end position of the last token consumed.
-func (s *scanner) scan() (end int) {
-	end = s.end
-	s.token = nil
-	for s.start = s.next; s.next < len(s.b); {
-		i := bytes.IndexByte(s.b[s.next:], '-')
-		if i == -1 {
-			s.end = len(s.b)
-			s.next = len(s.b)
-			i = s.end - s.start
-		} else {
-			s.end = s.next + i
-			s.next = s.end + 1
-		}
-		token := s.b[s.start:s.end]
-		if i < 1 || i > 8 || !isAlphaNum(token) {
-			s.gobble(errSyntax)
-			continue
-		}
-		s.token = token
-		return end
-	}
-	if n := len(s.b); n > 0 && s.b[n-1] == '-' {
-		s.setError(errSyntax)
-		s.b = s.b[:len(s.b)-1]
-	}
-	s.done = true
-	return end
-}
-
-// acceptMinSize parses multiple tokens of the given size or greater.
-// It returns the end position of the last token consumed.
-func (s *scanner) acceptMinSize(min int) (end int) {
-	end = s.end
-	s.scan()
-	for ; len(s.token) >= min; s.scan() {
-		end = s.end
-	}
-	return end
+	// Subtag returns the subtag for which the error occurred.
+	Subtag() string
 }
 
 // Parse parses the given BCP 47 string and returns a valid Tag. If parsing
@@ -238,324 +43,15 @@
 // http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
 // The resulting tag is canonicalized using the the canonicalization type c.
 func (c CanonType) Parse(s string) (t Tag, err error) {
-	// TODO: consider supporting old-style locale key-value pairs.
-	if s == "" {
-		return und, errSyntax
+	tt, err := language.Parse(s)
+	if err != nil {
+		return Tag{tt}, err
 	}
-	if len(s) <= maxAltTaglen {
-		b := [maxAltTaglen]byte{}
-		for i, c := range s {
-			// Generating invalid UTF-8 is okay as it won't match.
-			if 'A' <= c && c <= 'Z' {
-				c += 'a' - 'A'
-			} else if c == '_' {
-				c = '-'
-			}
-			b[i] = byte(c)
-		}
-		if t, ok := grandfathered(b); ok {
-			return t, nil
-		}
-	}
-	scan := makeScannerString(s)
-	t, err = parse(&scan, s)
-	t, changed := t.canonicalize(c)
+	tt, changed := canonicalize(c, tt)
 	if changed {
-		t.remakeString()
+		tt.RemakeString()
 	}
-	return t, err
-}
-
-func parse(scan *scanner, s string) (t Tag, err error) {
-	t = und
-	var end int
-	if n := len(scan.token); n <= 1 {
-		scan.toLower(0, len(scan.b))
-		if n == 0 || scan.token[0] != 'x' {
-			return t, errSyntax
-		}
-		end = parseExtensions(scan)
-	} else if n >= 4 {
-		return und, errSyntax
-	} else { // the usual case
-		t, end = parseTag(scan)
-		if n := len(scan.token); n == 1 {
-			t.pExt = uint16(end)
-			end = parseExtensions(scan)
-		} else if end < len(scan.b) {
-			scan.setError(errSyntax)
-			scan.b = scan.b[:end]
-		}
-	}
-	if int(t.pVariant) < len(scan.b) {
-		if end < len(s) {
-			s = s[:end]
-		}
-		if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
-			t.str = s
-		} else {
-			t.str = string(scan.b)
-		}
-	} else {
-		t.pVariant, t.pExt = 0, 0
-	}
-	return t, scan.err
-}
-
-// parseTag parses language, script, region and variants.
-// It returns a Tag and the end position in the input that was parsed.
-func parseTag(scan *scanner) (t Tag, end int) {
-	var e error
-	// TODO: set an error if an unknown lang, script or region is encountered.
-	t.lang, e = getLangID(scan.token)
-	scan.setError(e)
-	scan.replace(t.lang.String())
-	langStart := scan.start
-	end = scan.scan()
-	for len(scan.token) == 3 && isAlpha(scan.token[0]) {
-		// From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
-		// to a tag of the form <extlang>.
-		lang, e := getLangID(scan.token)
-		if lang != 0 {
-			t.lang = lang
-			copy(scan.b[langStart:], lang.String())
-			scan.b[langStart+3] = '-'
-			scan.start = langStart + 4
-		}
-		scan.gobble(e)
-		end = scan.scan()
-	}
-	if len(scan.token) == 4 && isAlpha(scan.token[0]) {
-		t.script, e = getScriptID(script, scan.token)
-		if t.script == 0 {
-			scan.gobble(e)
-		}
-		end = scan.scan()
-	}
-	if n := len(scan.token); n >= 2 && n <= 3 {
-		t.region, e = getRegionID(scan.token)
-		if t.region == 0 {
-			scan.gobble(e)
-		} else {
-			scan.replace(t.region.String())
-		}
-		end = scan.scan()
-	}
-	scan.toLower(scan.start, len(scan.b))
-	t.pVariant = byte(end)
-	end = parseVariants(scan, end, t)
-	t.pExt = uint16(end)
-	return t, end
-}
-
-var separator = []byte{'-'}
-
-// parseVariants scans tokens as long as each token is a valid variant string.
-// Duplicate variants are removed.
-func parseVariants(scan *scanner, end int, t Tag) int {
-	start := scan.start
-	varIDBuf := [4]uint8{}
-	variantBuf := [4][]byte{}
-	varID := varIDBuf[:0]
-	variant := variantBuf[:0]
-	last := -1
-	needSort := false
-	for ; len(scan.token) >= 4; scan.scan() {
-		// TODO: measure the impact of needing this conversion and redesign
-		// the data structure if there is an issue.
-		v, ok := variantIndex[string(scan.token)]
-		if !ok {
-			// unknown variant
-			// TODO: allow user-defined variants?
-			scan.gobble(mkErrInvalid(scan.token))
-			continue
-		}
-		varID = append(varID, v)
-		variant = append(variant, scan.token)
-		if !needSort {
-			if last < int(v) {
-				last = int(v)
-			} else {
-				needSort = true
-				// There is no legal combinations of more than 7 variants
-				// (and this is by no means a useful sequence).
-				const maxVariants = 8
-				if len(varID) > maxVariants {
-					break
-				}
-			}
-		}
-		end = scan.end
-	}
-	if needSort {
-		sort.Sort(variantsSort{varID, variant})
-		k, l := 0, -1
-		for i, v := range varID {
-			w := int(v)
-			if l == w {
-				// Remove duplicates.
-				continue
-			}
-			varID[k] = varID[i]
-			variant[k] = variant[i]
-			k++
-			l = w
-		}
-		if str := bytes.Join(variant[:k], separator); len(str) == 0 {
-			end = start - 1
-		} else {
-			scan.resizeRange(start, end, len(str))
-			copy(scan.b[scan.start:], str)
-			end = scan.end
-		}
-	}
-	return end
-}
-
-type variantsSort struct {
-	i []uint8
-	v [][]byte
-}
-
-func (s variantsSort) Len() int {
-	return len(s.i)
-}
-
-func (s variantsSort) Swap(i, j int) {
-	s.i[i], s.i[j] = s.i[j], s.i[i]
-	s.v[i], s.v[j] = s.v[j], s.v[i]
-}
-
-func (s variantsSort) Less(i, j int) bool {
-	return s.i[i] < s.i[j]
-}
-
-type bytesSort [][]byte
-
-func (b bytesSort) Len() int {
-	return len(b)
-}
-
-func (b bytesSort) Swap(i, j int) {
-	b[i], b[j] = b[j], b[i]
-}
-
-func (b bytesSort) Less(i, j int) bool {
-	return bytes.Compare(b[i], b[j]) == -1
-}
-
-// parseExtensions parses and normalizes the extensions in the buffer.
-// It returns the last position of scan.b that is part of any extension.
-// It also trims scan.b to remove excess parts accordingly.
-func parseExtensions(scan *scanner) int {
-	start := scan.start
-	exts := [][]byte{}
-	private := []byte{}
-	end := scan.end
-	for len(scan.token) == 1 {
-		extStart := scan.start
-		ext := scan.token[0]
-		end = parseExtension(scan)
-		extension := scan.b[extStart:end]
-		if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
-			scan.setError(errSyntax)
-			end = extStart
-			continue
-		} else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
-			scan.b = scan.b[:end]
-			return end
-		} else if ext == 'x' {
-			private = extension
-			break
-		}
-		exts = append(exts, extension)
-	}
-	sort.Sort(bytesSort(exts))
-	if len(private) > 0 {
-		exts = append(exts, private)
-	}
-	scan.b = scan.b[:start]
-	if len(exts) > 0 {
-		scan.b = append(scan.b, bytes.Join(exts, separator)...)
-	} else if start > 0 {
-		// Strip trailing '-'.
-		scan.b = scan.b[:start-1]
-	}
-	return end
-}
-
-// parseExtension parses a single extension and returns the position of
-// the extension end.
-func parseExtension(scan *scanner) int {
-	start, end := scan.start, scan.end
-	switch scan.token[0] {
-	case 'u':
-		attrStart := end
-		scan.scan()
-		for last := []byte{}; len(scan.token) > 2; scan.scan() {
-			if bytes.Compare(scan.token, last) != -1 {
-				// Attributes are unsorted. Start over from scratch.
-				p := attrStart + 1
-				scan.next = p
-				attrs := [][]byte{}
-				for scan.scan(); len(scan.token) > 2; scan.scan() {
-					attrs = append(attrs, scan.token)
-					end = scan.end
-				}
-				sort.Sort(bytesSort(attrs))
-				copy(scan.b[p:], bytes.Join(attrs, separator))
-				break
-			}
-			last = scan.token
-			end = scan.end
-		}
-		var last, key []byte
-		for attrEnd := end; len(scan.token) == 2; last = key {
-			key = scan.token
-			keyEnd := scan.end
-			end = scan.acceptMinSize(3)
-			// TODO: check key value validity
-			if keyEnd == end || bytes.Compare(key, last) != 1 {
-				// We have an invalid key or the keys are not sorted.
-				// Start scanning keys from scratch and reorder.
-				p := attrEnd + 1
-				scan.next = p
-				keys := [][]byte{}
-				for scan.scan(); len(scan.token) == 2; {
-					keyStart, keyEnd := scan.start, scan.end
-					end = scan.acceptMinSize(3)
-					if keyEnd != end {
-						keys = append(keys, scan.b[keyStart:end])
-					} else {
-						scan.setError(errSyntax)
-						end = keyStart
-					}
-				}
-				sort.Sort(bytesSort(keys))
-				reordered := bytes.Join(keys, separator)
-				if e := p + len(reordered); e < end {
-					scan.deleteRange(e, end)
-					end = e
-				}
-				copy(scan.b[p:], bytes.Join(keys, separator))
-				break
-			}
-		}
-	case 't':
-		scan.scan()
-		if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
-			_, end = parseTag(scan)
-			scan.toLower(start, end)
-		}
-		for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
-			end = scan.acceptMinSize(3)
-		}
-	case 'x':
-		end = scan.acceptMinSize(1)
-	default:
-		end = scan.acceptMinSize(2)
-	}
-	return end
+	return Tag{tt}, err
 }
 
 // Compose creates a Tag from individual parts, which may be of type Tag, Base,
@@ -581,58 +77,20 @@
 // canonicalizing using CanonType c. If one or more errors are encountered,
 // one of the errors is returned.
 func (c CanonType) Compose(part ...interface{}) (t Tag, err error) {
-	var b builder
-	if err = b.update(part...); err != nil {
+	var b language.Builder
+	if err = update(&b, part...); err != nil {
 		return und, err
 	}
-	t, _ = b.tag.canonicalize(c)
-
-	if len(b.ext) > 0 || len(b.variant) > 0 {
-		sort.Sort(sortVariant(b.variant))
-		sort.Strings(b.ext)
-		if b.private != "" {
-			b.ext = append(b.ext, b.private)
-		}
-		n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...)
-		buf := make([]byte, n)
-		p := t.genCoreBytes(buf)
-		t.pVariant = byte(p)
-		p += appendTokens(buf[p:], b.variant...)
-		t.pExt = uint16(p)
-		p += appendTokens(buf[p:], b.ext...)
-		t.str = string(buf[:p])
-	} else if b.private != "" {
-		t.str = b.private
-		t.remakeString()
-	}
-	return
-}
-
-type builder struct {
-	tag Tag
-
-	private string // the x extension
-	ext     []string
-	variant []string
-
-	err error
-}
-
-func (b *builder) addExt(e string) {
-	if e == "" {
-	} else if e[0] == 'x' {
-		b.private = e
-	} else {
-		b.ext = append(b.ext, e)
-	}
+	b.Tag, _ = canonicalize(c, b.Tag)
+	return Tag{b.Make()}, err
 }
 
 var errInvalidArgument = errors.New("invalid Extension or Variant")
 
-func (b *builder) update(part ...interface{}) (err error) {
+func update(b *language.Builder, part ...interface{}) (err error) {
 	replace := func(l *[]string, s string, eq func(a, b string) bool) bool {
 		if s == "" {
-			b.err = errInvalidArgument
+			b.Err = errInvalidArgument
 			return true
 		}
 		for i, v := range *l {
@@ -646,44 +104,41 @@
 	for _, x := range part {
 		switch v := x.(type) {
 		case Tag:
-			b.tag.lang = v.lang
-			b.tag.region = v.region
-			b.tag.script = v.script
-			if v.str != "" {
-				b.variant = nil
-				for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; {
-					x, s = nextToken(s)
-					b.variant = append(b.variant, x)
-				}
-				b.ext, b.private = nil, ""
-				for i, e := int(v.pExt), ""; i < len(v.str); {
-					i, e = getExtension(v.str, i)
-					b.addExt(e)
-				}
+			b.Tag.LangID = v.lang()
+			b.Tag.RegionID = v.region()
+			b.Tag.ScriptID = v.script()
+			// TODO: optimize
+			b.Variant = b.Variant[:0]
+			for _, vr := range v.Variants() {
+				b.Variant = append(b.Variant, vr.String())
+			}
+			b.Ext, b.Private = b.Ext[:0], ""
+			for _, e := range v.Extensions() {
+				b.AddExt(e.String())
 			}
 		case Base:
-			b.tag.lang = v.langID
+			b.Tag.LangID = v.langID
 		case Script:
-			b.tag.script = v.scriptID
+			b.Tag.ScriptID = v.scriptID
 		case Region:
-			b.tag.region = v.regionID
+			b.Tag.RegionID = v.regionID
 		case Variant:
-			if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) {
-				b.variant = append(b.variant, v.variant)
+			if !replace(&b.Variant, v.variant, func(a, b string) bool { return a == b }) {
+				b.Variant = append(b.Variant, v.variant)
 			}
 		case Extension:
-			if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) {
-				b.addExt(v.s)
+			if !replace(&b.Ext, v.s, func(a, b string) bool { return a[0] == b[0] }) {
+				b.AddExt(v.s)
 			}
 		case []Variant:
-			b.variant = nil
+			b.Variant = nil
 			for _, x := range v {
-				b.update(x)
+				update(b, x)
 			}
 		case []Extension:
-			b.ext, b.private = nil, ""
+			b.Ext, b.Private = nil, ""
 			for _, e := range v {
-				b.update(e)
+				update(b, e)
 			}
 		// TODO: support parsing of raw strings based on morphology or just extensions?
 		case error:
@@ -693,76 +148,6 @@
 	return
 }
 
-func tokenLen(token ...string) (n int) {
-	for _, t := range token {
-		n += len(t) + 1
-	}
-	return
-}
-
-func appendTokens(b []byte, token ...string) int {
-	p := 0
-	for _, t := range token {
-		b[p] = '-'
-		copy(b[p+1:], t)
-		p += 1 + len(t)
-	}
-	return p
-}
-
-type sortVariant []string
-
-func (s sortVariant) Len() int {
-	return len(s)
-}
-
-func (s sortVariant) Swap(i, j int) {
-	s[j], s[i] = s[i], s[j]
-}
-
-func (s sortVariant) Less(i, j int) bool {
-	return variantIndex[s[i]] < variantIndex[s[j]]
-}
-
-func findExt(list []string, x byte) int {
-	for i, e := range list {
-		if e[0] == x {
-			return i
-		}
-	}
-	return -1
-}
-
-// getExtension returns the name, body and end position of the extension.
-func getExtension(s string, p int) (end int, ext string) {
-	if s[p] == '-' {
-		p++
-	}
-	if s[p] == 'x' {
-		return len(s), s[p:]
-	}
-	end = nextExtension(s, p)
-	return end, s[p:end]
-}
-
-// nextExtension finds the next extension within the string, searching
-// for the -<char>- pattern from position p.
-// In the fast majority of cases, language tags will have at most
-// one extension and extensions tend to be small.
-func nextExtension(s string, p int) int {
-	for n := len(s) - 3; p < n; {
-		if s[p] == '-' {
-			if s[p+2] == '-' {
-				return p
-			}
-			p += 3
-		} else {
-			p++
-		}
-	}
-	return len(s)
-}
-
 var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight")
 
 // ParseAcceptLanguage parses the contents of an Accept-Language header as
@@ -788,7 +173,7 @@
 			if !ok {
 				return nil, nil, err
 			}
-			t = Tag{lang: id}
+			t = Tag{tag: language.Tag{LangID: id}}
 		}
 
 		// Scan the optional weight.
diff --git a/language/parse_test.go b/language/parse_test.go
index 9b40eb4..fe6bc0d 100644
--- a/language/parse_test.go
+++ b/language/parse_test.go
@@ -5,88 +5,20 @@
 package language
 
 import (
-	"bytes"
 	"strings"
 	"testing"
 
-	"golang.org/x/text/internal/tag"
+	"golang.org/x/text/language/internal"
 )
 
-type scanTest struct {
-	ok  bool // true if scanning does not result in an error
-	in  string
-	tok []string // the expected tokens
+// equalTags compares language, script and region subtags only.
+func (t Tag) equalTags(a Tag) bool {
+	return t.lang() == a.lang() &&
+		t.script() == a.script() &&
+		t.region() == a.region()
 }
 
-var tests = []scanTest{
-	{true, "", []string{}},
-	{true, "1", []string{"1"}},
-	{true, "en", []string{"en"}},
-	{true, "root", []string{"root"}},
-	{true, "maxchars", []string{"maxchars"}},
-	{false, "bad/", []string{}},
-	{false, "morethan8", []string{}},
-	{false, "-", []string{}},
-	{false, "----", []string{}},
-	{false, "_", []string{}},
-	{true, "en-US", []string{"en", "US"}},
-	{true, "en_US", []string{"en", "US"}},
-	{false, "en-US-", []string{"en", "US"}},
-	{false, "en-US--", []string{"en", "US"}},
-	{false, "en-US---", []string{"en", "US"}},
-	{false, "en--US", []string{"en", "US"}},
-	{false, "-en-US", []string{"en", "US"}},
-	{false, "-en--US-", []string{"en", "US"}},
-	{false, "-en--US-", []string{"en", "US"}},
-	{false, "en-.-US", []string{"en", "US"}},
-	{false, ".-en--US-.", []string{"en", "US"}},
-	{false, "en-u.-US", []string{"en", "US"}},
-	{true, "en-u1-US", []string{"en", "u1", "US"}},
-	{true, "maxchar1_maxchar2-maxchar3", []string{"maxchar1", "maxchar2", "maxchar3"}},
-	{false, "moreThan8-moreThan8-e", []string{"e"}},
-}
-
-func TestScan(t *testing.T) {
-	for i, tt := range tests {
-		scan := makeScannerString(tt.in)
-		for j := 0; !scan.done; j++ {
-			if j >= len(tt.tok) {
-				t.Errorf("%d: extra token %q", i, scan.token)
-			} else if tag.Compare(tt.tok[j], scan.token) != 0 {
-				t.Errorf("%d: token %d: found %q; want %q", i, j, scan.token, tt.tok[j])
-				break
-			}
-			scan.scan()
-		}
-		if s := strings.Join(tt.tok, "-"); tag.Compare(s, bytes.Replace(scan.b, b("_"), b("-"), -1)) != 0 {
-			t.Errorf("%d: input: found %q; want %q", i, scan.b, s)
-		}
-		if (scan.err == nil) != tt.ok {
-			t.Errorf("%d: ok: found %v; want %v", i, scan.err == nil, tt.ok)
-		}
-	}
-}
-
-func TestAcceptMinSize(t *testing.T) {
-	for i, tt := range tests {
-		// count number of successive tokens with a minimum size.
-		for sz := 1; sz <= 8; sz++ {
-			scan := makeScannerString(tt.in)
-			scan.end, scan.next = 0, 0
-			end := scan.acceptMinSize(sz)
-			n := 0
-			for i := 0; i < len(tt.tok) && len(tt.tok[i]) >= sz; i++ {
-				n += len(tt.tok[i])
-				if i > 0 {
-					n++
-				}
-			}
-			if end != n {
-				t.Errorf("%d:%d: found len %d; want %d", i, sz, end, n)
-			}
-		}
-	}
-}
+var errSyntax = language.ErrSyntax
 
 type parseTest struct {
 	i                    int // the index of this test
@@ -231,30 +163,6 @@
 	return tests
 }
 
-func TestParseExtensions(t *testing.T) {
-	for i, tt := range parseTests() {
-		if tt.ext == "" || tt.rewrite {
-			continue
-		}
-		scan := makeScannerString(tt.in)
-		if len(scan.b) > 1 && scan.b[1] != '-' {
-			scan.end = nextExtension(string(scan.b), 0)
-			scan.next = scan.end + 1
-			scan.scan()
-		}
-		start := scan.start
-		scan.toLower(start, len(scan.b))
-		parseExtensions(&scan)
-		ext := string(scan.b[start:])
-		if ext != tt.ext {
-			t.Errorf("%d(%s): ext was %v; want %v", i, tt.in, ext, tt.ext)
-		}
-		if changed := !strings.HasPrefix(tt.in[start:], ext); changed != tt.changed {
-			t.Errorf("%d(%s): changed was %v; want %v", i, tt.in, changed, tt.changed)
-		}
-	}
-}
-
 // partChecks runs checks for each part by calling the function returned by f.
 func partChecks(t *testing.T, f func(*parseTest) (Tag, bool)) {
 	for i, tt := range parseTests() {
@@ -262,80 +170,38 @@
 		if skip {
 			continue
 		}
-		if l, _ := getLangID(b(tt.lang)); l != tag.lang {
-			t.Errorf("%d: lang was %q; want %q", i, tag.lang, l)
+		if l, _ := language.ParseBase(tt.lang); l != tag.lang() {
+			t.Errorf("%d: lang was %q; want %q", i, tag.lang(), l)
 		}
-		if sc, _ := getScriptID(script, b(tt.script)); sc != tag.script {
-			t.Errorf("%d: script was %q; want %q", i, tag.script, sc)
+		if sc, _ := language.ParseScript(tt.script); sc != tag.script() {
+			t.Errorf("%d: script was %q; want %q", i, tag.script(), sc)
 		}
-		if r, _ := getRegionID(b(tt.region)); r != tag.region {
-			t.Errorf("%d: region was %q; want %q", i, tag.region, r)
+		if r, _ := language.ParseRegion(tt.region); r != tag.region() {
+			t.Errorf("%d: region was %q; want %q", i, tag.region(), r)
 		}
-		if tag.str == "" {
-			continue
+		v := tag.tag.Variants()
+		if v != "" {
+			v = v[1:]
 		}
-		p := int(tag.pVariant)
-		if p < int(tag.pExt) {
-			p++
+		if v != tt.variants {
+			t.Errorf("%d: variants was %q; want %q", i, v, tt.variants)
 		}
-		if s, g := tag.str[p:tag.pExt], tt.variants; s != g {
-			t.Errorf("%d: variants was %q; want %q", i, s, g)
-		}
-		p = int(tag.pExt)
-		if p > 0 && p < len(tag.str) {
-			p++
-		}
-		if s, g := (tag.str)[p:], tt.ext; s != g {
-			t.Errorf("%d: extensions were %q; want %q", i, s, g)
+		if e := strings.Join(tag.tag.Extensions(), "-"); e != tt.ext {
+			t.Errorf("%d: extensions were %q; want %q", i, e, tt.ext)
 		}
 	}
 }
 
-func TestParseTag(t *testing.T) {
-	partChecks(t, func(tt *parseTest) (id Tag, skip bool) {
-		if strings.HasPrefix(tt.in, "x-") || tt.rewrite {
-			return Tag{}, true
-		}
-		scan := makeScannerString(tt.in)
-		id, end := parseTag(&scan)
-		id.str = string(scan.b[:end])
-		tt.ext = ""
-		tt.extList = []string{}
-		return id, false
-	})
-}
-
 func TestParse(t *testing.T) {
 	partChecks(t, func(tt *parseTest) (id Tag, skip bool) {
-		id, err := Raw.Parse(tt.in)
-		ext := ""
-		if id.str != "" {
-			if strings.HasPrefix(id.str, "x-") {
-				ext = id.str
-			} else if int(id.pExt) < len(id.str) && id.pExt > 0 {
-				ext = id.str[id.pExt+1:]
-			}
-		}
-		if tag, _ := Raw.Parse(id.String()); tag.String() != id.String() {
-			t.Errorf("%d:%s: reparse was %q; want %q", tt.i, tt.in, id.String(), tag.String())
-		}
-		if ext != tt.ext {
-			t.Errorf("%d:%s: ext was %q; want %q", tt.i, tt.in, ext, tt.ext)
-		}
-		changed := id.str != "" && !strings.HasPrefix(tt.in, id.str)
-		if changed != tt.changed {
-			t.Errorf("%d:%s: changed was %v; want %v", tt.i, tt.in, changed, tt.changed)
-		}
-		if (err != nil) != tt.invalid {
-			t.Errorf("%d:%s: invalid was %v; want %v. Error: %v", tt.i, tt.in, err != nil, tt.invalid, err)
-		}
+		id, _ = Raw.Parse(tt.in)
 		return id, false
 	})
 }
 
 func TestErrors(t *testing.T) {
 	mkInvalid := func(s string) error {
-		return mkErrInvalid([]byte(s))
+		return language.NewValueError([]byte(s))
 	}
 	tests := []struct {
 		in  string
diff --git a/language/tables.go b/language/tables.go
index b738d45..cb7e1f8 100644
--- a/language/tables.go
+++ b/language/tables.go
@@ -2,23 +2,9 @@
 
 package language
 
-import "golang.org/x/text/internal/tag"
-
 // CLDRVersion is the CLDR version from which the tables in this package are derived.
 const CLDRVersion = "32"
 
-const numLanguages = 8665
-
-const numScripts = 242
-
-const numRegions = 357
-
-type fromTo struct {
-	from uint16
-	to   uint16
-}
-
-const nonCanonicalUnd = 1201
 const (
 	_af  = 22
 	_am  = 39
@@ -113,886 +99,6 @@
 	_nan = 835
 	_hsn = 467
 )
-
-const langPrivateStart = 0x2f72
-
-const langPrivateEnd = 0x3179
-
-// lang holds an alphabetically sorted list of ISO-639 language identifiers.
-// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
-// For 2-byte language identifiers, the two successive bytes have the following meaning:
-//     - if the first letter of the 2- and 3-letter ISO codes are the same:
-//       the second and third letter of the 3-letter ISO code.
-//     - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
-// For 3-byte language identifiers the 4th byte is 0.
-const lang tag.Index = "" + // Size: 5324 bytes
-	"---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
-	"cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
-	"\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
-	"jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
-	"p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
-	"ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
-	"\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
-	"tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
-	"\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
-	"bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
-	"m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
-	"bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
-	"\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
-	"\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
-	"\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
-	"\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
-	"bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
-	"\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
-	"uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
-	"\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
-	"\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
-	"\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
-	"kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
-	"j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
-	"andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
-	"ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
-	"\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
-	"\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
-	"yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
-	"llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
-	"\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
-	"\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
-	"foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
-	"ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
-	"ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
-	"\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
-	"ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
-	"\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
-	"\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
-	"\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
-	"\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
-	"aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
-	"l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
-	"hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
-	"\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
-	"eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
-	"lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
-	"ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
-	"\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
-	"\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
-	"\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
-	"\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
-	"ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
-	"\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
-	"klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
-	"nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
-	"\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
-	"rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
-	"\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
-	"us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
-	"\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
-	"\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
-	"ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
-	"d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
-	"\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
-	"\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
-	"lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
-	"w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
-	"\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
-	"\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
-	"\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
-	"min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
-	"ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
-	"e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
-	"mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
-	"us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
-	"\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
-	"\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
-	"bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
-	"\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
-	"if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
-	"dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
-	"nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
-	"\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
-	"\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
-	"opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
-	"\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
-	"\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
-	"\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
-	"ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
-	"f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
-	"rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
-	"ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
-	"\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
-	"ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
-	"i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
-	"\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
-	"\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
-	"\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
-	"\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
-	"\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
-	"sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
-	"yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
-	"\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
-	"ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
-	"q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
-	"\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
-	"tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
-	"sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
-	"\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
-	"wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
-	"\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
-	"vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
-	"\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
-	"\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
-	"\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
-	"\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
-	"bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
-	"\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
-	"\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
-	"\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
-	"ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
-	"\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
-	"\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
-
-const langNoIndexOffset = 1330
-
-// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
-// in lookup tables. The language ids for these language codes are derived directly
-// from the letters and are not consecutive.
-// Size: 2197 bytes, 2197 elements
-var langNoIndex = [2197]uint8{
-	// Entry 0 - 3F
-	0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
-	0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
-	0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
-	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
-	0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
-	0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
-	0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
-	0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
-	// Entry 40 - 7F
-	0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
-	0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
-	0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
-	0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
-	0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
-	0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
-	0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
-	0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
-	// Entry 80 - BF
-	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
-	0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
-	0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
-	0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
-	0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
-	0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
-	0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
-	0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
-	// Entry C0 - FF
-	0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
-	0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
-	0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
-	0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
-	0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
-	0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
-	0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
-	0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
-	// Entry 100 - 13F
-	0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
-	0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
-	0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
-	0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
-	0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
-	0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
-	0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
-	0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
-	// Entry 140 - 17F
-	0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
-	0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
-	0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
-	0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
-	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
-	0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
-	0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
-	0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
-	// Entry 180 - 1BF
-	0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
-	0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
-	0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
-	// Entry 1C0 - 1FF
-	0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
-	0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
-	0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
-	0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
-	0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
-	// Entry 200 - 23F
-	0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
-	0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
-	0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
-	0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
-	0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
-	0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
-	0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
-	0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
-	// Entry 240 - 27F
-	0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
-	0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
-	0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
-	0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
-	0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
-	0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
-	0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
-	// Entry 280 - 2BF
-	0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
-	0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
-	0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
-	0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
-	0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
-	0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
-	0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
-	0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
-	// Entry 2C0 - 2FF
-	0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
-	0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
-	0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
-	0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
-	0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
-	0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
-	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
-	0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
-	// Entry 300 - 33F
-	0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
-	0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
-	0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
-	0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
-	0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
-	0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
-	0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
-	0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
-	// Entry 340 - 37F
-	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
-	0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
-	0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
-	0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
-	0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
-	0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
-	0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
-	0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
-	// Entry 380 - 3BF
-	0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
-	0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
-	0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
-	0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
-	0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
-	0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
-	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
-	0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
-	// Entry 3C0 - 3FF
-	0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
-	0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
-	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
-	0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
-	0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
-	0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
-	0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
-	0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
-	// Entry 400 - 43F
-	0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
-	0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
-	0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
-	0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
-	0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
-	0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
-	0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
-	0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
-	// Entry 440 - 47F
-	0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
-	0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
-	0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
-	0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
-	0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
-	0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
-	0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
-	0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
-	// Entry 480 - 4BF
-	0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
-	0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
-	0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
-	0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
-	0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
-	0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
-	0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
-	// Entry 4C0 - 4FF
-	0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
-	0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
-	0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
-	0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
-	0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
-	0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
-	0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
-	// Entry 500 - 53F
-	0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
-	0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
-	0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
-	0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
-	0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
-	0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
-	0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
-	0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
-	// Entry 540 - 57F
-	0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	// Entry 580 - 5BF
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
-	0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
-	0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
-	0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
-	0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
-	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
-	0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
-	// Entry 5C0 - 5FF
-	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
-	0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
-	0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
-	0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
-	0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
-	0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
-	0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
-	0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
-	// Entry 600 - 63F
-	0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
-	0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
-	0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
-	0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
-	0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
-	0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
-	0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
-	0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
-	// Entry 640 - 67F
-	0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c,
-	0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
-	0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
-	0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
-	0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
-	0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
-	0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
-	0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
-	// Entry 680 - 6BF
-	0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
-	0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
-	0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
-	0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
-	0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
-	0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
-	0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f,
-	// Entry 6C0 - 6FF
-	0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
-	0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
-	0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
-	0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
-	0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
-	0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
-	// Entry 700 - 73F
-	0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
-	0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
-	0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
-	0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
-	0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
-	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 740 - 77F
-	0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
-	0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
-	0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
-	0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
-	0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
-	0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
-	0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
-	// Entry 780 - 7BF
-	0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
-	0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
-	0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
-	0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
-	0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
-	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
-	0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
-	0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
-	// Entry 7C0 - 7FF
-	0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
-	0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
-	0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
-	0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
-	0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
-	0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
-	0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
-	0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
-	// Entry 800 - 83F
-	0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
-	0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
-	0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
-	0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
-	0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
-	0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
-	0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
-	0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
-	// Entry 840 - 87F
-	0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
-	0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
-	0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
-	0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
-	0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
-	0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
-	0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
-	// Entry 880 - 8BF
-	0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
-	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
-	0x0a, 0x00, 0x80, 0x00, 0x00,
-}
-
-// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
-// to 2-letter language codes that cannot be derived using the method described above.
-// Each 3-letter code is followed by its 1-byte langID.
-const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
-
-// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
-// Size: 12 bytes, 6 elements
-var altLangIndex = [6]uint16{
-	0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
-}
-
-// langAliasMap maps langIDs to their suggested replacements.
-// Size: 656 bytes, 164 elements
-var langAliasMap = [164]fromTo{
-	0:   {from: 0x82, to: 0x88},
-	1:   {from: 0x187, to: 0x1ae},
-	2:   {from: 0x1f3, to: 0x1e1},
-	3:   {from: 0x1fb, to: 0x1bc},
-	4:   {from: 0x208, to: 0x512},
-	5:   {from: 0x20f, to: 0x20e},
-	6:   {from: 0x310, to: 0x3dc},
-	7:   {from: 0x347, to: 0x36f},
-	8:   {from: 0x407, to: 0x432},
-	9:   {from: 0x47a, to: 0x153},
-	10:  {from: 0x490, to: 0x451},
-	11:  {from: 0x4a2, to: 0x21},
-	12:  {from: 0x53e, to: 0x544},
-	13:  {from: 0x58f, to: 0x12d},
-	14:  {from: 0x630, to: 0x1eb1},
-	15:  {from: 0x651, to: 0x431},
-	16:  {from: 0x662, to: 0x431},
-	17:  {from: 0x6ed, to: 0x3a},
-	18:  {from: 0x6f8, to: 0x1d7},
-	19:  {from: 0x73e, to: 0x21a1},
-	20:  {from: 0x7b3, to: 0x56},
-	21:  {from: 0x7b9, to: 0x299b},
-	22:  {from: 0x7c5, to: 0x58},
-	23:  {from: 0x7e6, to: 0x145},
-	24:  {from: 0x80c, to: 0x5a},
-	25:  {from: 0x815, to: 0x8d},
-	26:  {from: 0x87e, to: 0x810},
-	27:  {from: 0x8c3, to: 0xee3},
-	28:  {from: 0x9ef, to: 0x331},
-	29:  {from: 0xa36, to: 0x2c5},
-	30:  {from: 0xa3d, to: 0xbf},
-	31:  {from: 0xabe, to: 0x3322},
-	32:  {from: 0xb38, to: 0x529},
-	33:  {from: 0xb75, to: 0x265a},
-	34:  {from: 0xb7e, to: 0xbc3},
-	35:  {from: 0xb9b, to: 0x44e},
-	36:  {from: 0xbbc, to: 0x4229},
-	37:  {from: 0xbbf, to: 0x529},
-	38:  {from: 0xbfe, to: 0x2da7},
-	39:  {from: 0xc2e, to: 0x3181},
-	40:  {from: 0xcb9, to: 0xf3},
-	41:  {from: 0xd08, to: 0xfa},
-	42:  {from: 0xdc8, to: 0x11a},
-	43:  {from: 0xdd7, to: 0x32d},
-	44:  {from: 0xdf8, to: 0xdfb},
-	45:  {from: 0xdfe, to: 0x531},
-	46:  {from: 0xedf, to: 0x205a},
-	47:  {from: 0xeee, to: 0x2e9a},
-	48:  {from: 0xf39, to: 0x367},
-	49:  {from: 0x10d0, to: 0x140},
-	50:  {from: 0x1104, to: 0x2d0},
-	51:  {from: 0x11a0, to: 0x1ec},
-	52:  {from: 0x1279, to: 0x21},
-	53:  {from: 0x1424, to: 0x15e},
-	54:  {from: 0x1470, to: 0x14e},
-	55:  {from: 0x151f, to: 0xd9b},
-	56:  {from: 0x1523, to: 0x390},
-	57:  {from: 0x1532, to: 0x19f},
-	58:  {from: 0x1580, to: 0x210},
-	59:  {from: 0x1583, to: 0x10d},
-	60:  {from: 0x15a3, to: 0x3caf},
-	61:  {from: 0x166a, to: 0x19b},
-	62:  {from: 0x16c8, to: 0x136},
-	63:  {from: 0x1700, to: 0x29f8},
-	64:  {from: 0x1718, to: 0x194},
-	65:  {from: 0x1727, to: 0xf3f},
-	66:  {from: 0x177a, to: 0x178},
-	67:  {from: 0x1809, to: 0x17b6},
-	68:  {from: 0x1816, to: 0x18f3},
-	69:  {from: 0x188a, to: 0x436},
-	70:  {from: 0x1979, to: 0x1d01},
-	71:  {from: 0x1a74, to: 0x2bb0},
-	72:  {from: 0x1a8a, to: 0x1f8},
-	73:  {from: 0x1b5a, to: 0x1fa},
-	74:  {from: 0x1b86, to: 0x1515},
-	75:  {from: 0x1d64, to: 0x2c9b},
-	76:  {from: 0x2038, to: 0x37b1},
-	77:  {from: 0x203d, to: 0x20dd},
-	78:  {from: 0x205a, to: 0x30b},
-	79:  {from: 0x20e3, to: 0x274},
-	80:  {from: 0x20ee, to: 0x263},
-	81:  {from: 0x20f2, to: 0x22d},
-	82:  {from: 0x20f9, to: 0x256},
-	83:  {from: 0x210f, to: 0x21eb},
-	84:  {from: 0x2135, to: 0x27d},
-	85:  {from: 0x2160, to: 0x913},
-	86:  {from: 0x2199, to: 0x121},
-	87:  {from: 0x21ce, to: 0x1561},
-	88:  {from: 0x21e6, to: 0x504},
-	89:  {from: 0x21f4, to: 0x49f},
-	90:  {from: 0x222d, to: 0x121},
-	91:  {from: 0x2237, to: 0x121},
-	92:  {from: 0x2262, to: 0x92a},
-	93:  {from: 0x2316, to: 0x3226},
-	94:  {from: 0x2382, to: 0x3365},
-	95:  {from: 0x2472, to: 0x2c7},
-	96:  {from: 0x24e4, to: 0x2ff},
-	97:  {from: 0x24f0, to: 0x2fa},
-	98:  {from: 0x24fa, to: 0x31f},
-	99:  {from: 0x2550, to: 0xb5b},
-	100: {from: 0x25a9, to: 0xe2},
-	101: {from: 0x263e, to: 0x2d0},
-	102: {from: 0x26c9, to: 0x26b4},
-	103: {from: 0x26f9, to: 0x3c8},
-	104: {from: 0x2727, to: 0x3caf},
-	105: {from: 0x2765, to: 0x26b4},
-	106: {from: 0x2789, to: 0x4358},
-	107: {from: 0x28ef, to: 0x2837},
-	108: {from: 0x2914, to: 0x351},
-	109: {from: 0x2986, to: 0x2da7},
-	110: {from: 0x2b1a, to: 0x38d},
-	111: {from: 0x2bfc, to: 0x395},
-	112: {from: 0x2c3f, to: 0x3caf},
-	113: {from: 0x2cfc, to: 0x3be},
-	114: {from: 0x2d13, to: 0x597},
-	115: {from: 0x2d47, to: 0x148},
-	116: {from: 0x2d48, to: 0x148},
-	117: {from: 0x2dff, to: 0x2f1},
-	118: {from: 0x2e08, to: 0x19cc},
-	119: {from: 0x2e1a, to: 0x2d95},
-	120: {from: 0x2e21, to: 0x292},
-	121: {from: 0x2e54, to: 0x7d},
-	122: {from: 0x2e65, to: 0x2282},
-	123: {from: 0x2ea0, to: 0x2e9b},
-	124: {from: 0x2eef, to: 0x2ed7},
-	125: {from: 0x3193, to: 0x3c4},
-	126: {from: 0x3366, to: 0x338e},
-	127: {from: 0x342a, to: 0x3dc},
-	128: {from: 0x34ee, to: 0x18d0},
-	129: {from: 0x35c8, to: 0x2c9b},
-	130: {from: 0x35e6, to: 0x412},
-	131: {from: 0x3658, to: 0x246},
-	132: {from: 0x3676, to: 0x3f4},
-	133: {from: 0x36fd, to: 0x445},
-	134: {from: 0x37c0, to: 0x121},
-	135: {from: 0x3816, to: 0x38f2},
-	136: {from: 0x382b, to: 0x2c9b},
-	137: {from: 0x382f, to: 0xa9},
-	138: {from: 0x3832, to: 0x3228},
-	139: {from: 0x386c, to: 0x39a6},
-	140: {from: 0x3892, to: 0x3fc0},
-	141: {from: 0x38a5, to: 0x39d7},
-	142: {from: 0x38b4, to: 0x1fa4},
-	143: {from: 0x38b5, to: 0x2e9a},
-	144: {from: 0x395c, to: 0x47e},
-	145: {from: 0x3b4e, to: 0xd91},
-	146: {from: 0x3b78, to: 0x137},
-	147: {from: 0x3c99, to: 0x4bc},
-	148: {from: 0x3fbd, to: 0x100},
-	149: {from: 0x4208, to: 0xa91},
-	150: {from: 0x42be, to: 0x573},
-	151: {from: 0x42f9, to: 0x3f60},
-	152: {from: 0x4378, to: 0x25a},
-	153: {from: 0x43cb, to: 0x36cb},
-	154: {from: 0x43cd, to: 0x10f},
-	155: {from: 0x44af, to: 0x3322},
-	156: {from: 0x44e3, to: 0x512},
-	157: {from: 0x45ca, to: 0x2409},
-	158: {from: 0x45dd, to: 0x26dc},
-	159: {from: 0x4610, to: 0x48ae},
-	160: {from: 0x46ae, to: 0x46a0},
-	161: {from: 0x473e, to: 0x4745},
-	162: {from: 0x4916, to: 0x31f},
-	163: {from: 0x49a7, to: 0x523},
-}
-
-// Size: 164 bytes, 164 elements
-var langAliasTypes = [164]langAliasType{
-	// Entry 0 - 3F
-	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
-	1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
-	2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
-	2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
-	// Entry 40 - 7F
-	1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1,
-	1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
-	2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
-	0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2,
-	// Entry 80 - BF
-	0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0,
-	1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0,
-	0, 1, 1, 1,
-}
-
-const (
-	_Latn = 87
-	_Hani = 54
-	_Hans = 56
-	_Hant = 57
-	_Qaaa = 139
-	_Qaai = 147
-	_Qabx = 188
-	_Zinh = 236
-	_Zyyy = 241
-	_Zzzz = 242
-)
-
-// script is an alphabetically sorted list of ISO 15924 codes. The index
-// of the script in the string, divided by 4, is the internal scriptID.
-const script tag.Index = "" + // Size: 976 bytes
-	"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
-	"BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" +
-	"DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" +
-	"HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" +
-	"KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" +
-	"LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" +
-	"ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" +
-	"OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" +
-	"QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" +
-	"QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" +
-	"QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" +
-	"ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" +
-	"TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" +
-	"YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
-
-// suppressScript is an index from langID to the dominant script for that language,
-// if it exists.  If a script is given, it should be suppressed from the language tag.
-// Size: 1330 bytes, 1330 elements
-var suppressScript = [1330]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 40 - 7F
-	0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
-	// Entry 80 - BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry C0 - FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 100 - 13F
-	0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00,
-	// Entry 140 - 17F
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 180 - 1BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00,
-	// Entry 1C0 - 1FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00,
-	// Entry 200 - 23F
-	0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 240 - 27F
-	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 280 - 2BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 2C0 - 2FF
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f,
-	// Entry 300 - 33F
-	0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	// Entry 340 - 37F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 380 - 3BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
-	// Entry 3C0 - 3FF
-	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 400 - 43F
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	// Entry 440 - 47F
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	// Entry 480 - 4BF
-	0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 4C0 - 4FF
-	0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 500 - 53F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00,
-}
-
 const (
 	_001 = 1
 	_419 = 31
@@ -1009,2290 +115,21 @@
 	_XC  = 325
 	_XK  = 333
 )
+const (
+	_Latn = 87
+	_Hani = 54
+	_Hans = 56
+	_Hant = 57
+	_Qaaa = 139
+	_Qaai = 147
+	_Qabx = 188
+	_Zinh = 236
+	_Zyyy = 241
+	_Zzzz = 242
+)
 
-// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
-// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
-// the UN.M49 codes used for groups.)
-const isoRegionOffset = 32
-
-// regionTypes defines the status of a region for various standards.
-// Size: 358 bytes, 358 elements
-var regionTypes = [358]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 40 - 7F
-	0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
-	0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
-	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 80 - BF
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry C0 - FF
-	0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	// Entry 100 - 13F
-	0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 140 - 17F
-	0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
-	0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
-}
-
-// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
-// Each 2-letter codes is followed by two bytes with the following meaning:
-//     - [A-Z}{2}: the first letter of the 2-letter code plus these two
-//                 letters form the 3-letter ISO code.
-//     - 0, n:     index into altRegionISO3.
-const regionISO tag.Index = "" + // Size: 1308 bytes
-	"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
-	"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
-	"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
-	"CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
-	"HYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSMFORO" +
-	"FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
-	"RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERLILSR" +
-	"IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
-	"\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
-	"LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
-	"MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
-	"NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
-	"\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
-	"QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
-	"SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
-	"SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
-	"UVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
-	"UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
-	"OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
-	"ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
-
-// altRegionISO3 holds a list of 3-letter region codes that cannot be
-// mapped to 2-letter codes using the default algorithm. This is a short list.
-const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
-
-// altRegionIDs holds a list of regionIDs the positions of which match those
-// of the 3-letter ISO codes in altRegionISO3.
-// Size: 22 bytes, 11 elements
-var altRegionIDs = [11]uint16{
-	0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
-	0x0121, 0x015f, 0x00dc,
-}
-
-// Size: 80 bytes, 20 elements
-var regionOldMap = [20]fromTo{
-	0:  {from: 0x44, to: 0xc4},
-	1:  {from: 0x58, to: 0xa7},
-	2:  {from: 0x5f, to: 0x60},
-	3:  {from: 0x66, to: 0x3b},
-	4:  {from: 0x79, to: 0x78},
-	5:  {from: 0x93, to: 0x37},
-	6:  {from: 0xa3, to: 0x133},
-	7:  {from: 0xc1, to: 0x133},
-	8:  {from: 0xd7, to: 0x13f},
-	9:  {from: 0xdc, to: 0x2b},
-	10: {from: 0xef, to: 0x133},
-	11: {from: 0xf2, to: 0xe2},
-	12: {from: 0xfc, to: 0x70},
-	13: {from: 0x103, to: 0x164},
-	14: {from: 0x12a, to: 0x126},
-	15: {from: 0x132, to: 0x7b},
-	16: {from: 0x13a, to: 0x13e},
-	17: {from: 0x141, to: 0x133},
-	18: {from: 0x15d, to: 0x15e},
-	19: {from: 0x163, to: 0x4b},
-}
-
-// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
-// codes indicating collections of regions.
-// Size: 716 bytes, 358 elements
-var m49 = [358]int16{
-	// Entry 0 - 3F
-	0, 1, 2, 3, 5, 9, 11, 13,
-	14, 15, 17, 18, 19, 21, 29, 30,
-	34, 35, 39, 53, 54, 57, 61, 142,
-	143, 145, 150, 151, 154, 155, 202, 419,
-	958, 0, 20, 784, 4, 28, 660, 8,
-	51, 530, 24, 10, 32, 16, 40, 36,
-	533, 248, 31, 70, 52, 50, 56, 854,
-	100, 48, 108, 204, 652, 60, 96, 68,
-	// Entry 40 - 7F
-	535, 76, 44, 64, 104, 74, 72, 112,
-	84, 124, 166, 180, 140, 178, 756, 384,
-	184, 152, 120, 156, 170, 0, 188, 891,
-	296, 192, 132, 531, 162, 196, 203, 278,
-	276, 0, 262, 208, 212, 214, 204, 12,
-	0, 218, 233, 818, 732, 232, 724, 231,
-	967, 0, 246, 242, 238, 583, 234, 0,
-	250, 249, 266, 826, 308, 268, 254, 831,
-	// Entry 80 - BF
-	288, 292, 304, 270, 324, 312, 226, 300,
-	239, 320, 316, 624, 328, 344, 334, 340,
-	191, 332, 348, 854, 0, 360, 372, 376,
-	833, 356, 86, 368, 364, 352, 380, 832,
-	388, 400, 392, 581, 404, 417, 116, 296,
-	174, 659, 408, 410, 414, 136, 398, 418,
-	422, 662, 438, 144, 430, 426, 440, 442,
-	428, 434, 504, 492, 498, 499, 663, 450,
-	// Entry C0 - FF
-	584, 581, 807, 466, 104, 496, 446, 580,
-	474, 478, 500, 470, 480, 462, 454, 484,
-	458, 508, 516, 540, 562, 574, 566, 548,
-	558, 528, 578, 524, 10, 520, 536, 570,
-	554, 512, 591, 0, 604, 258, 598, 608,
-	586, 616, 666, 612, 630, 275, 620, 581,
-	585, 600, 591, 634, 959, 960, 961, 962,
-	963, 964, 965, 966, 967, 968, 969, 970,
-	// Entry 100 - 13F
-	971, 972, 638, 716, 642, 688, 643, 646,
-	682, 90, 690, 729, 752, 702, 654, 705,
-	744, 703, 694, 674, 686, 706, 740, 728,
-	678, 810, 222, 534, 760, 748, 0, 796,
-	148, 260, 768, 764, 762, 772, 626, 795,
-	788, 776, 626, 792, 780, 798, 158, 834,
-	804, 800, 826, 581, 0, 840, 858, 860,
-	336, 670, 704, 862, 92, 850, 704, 548,
-	// Entry 140 - 17F
-	876, 581, 882, 973, 974, 975, 976, 977,
-	978, 979, 980, 981, 982, 983, 984, 985,
-	986, 987, 988, 989, 990, 991, 992, 993,
-	994, 995, 996, 997, 998, 720, 887, 175,
-	891, 710, 894, 180, 716, 999,
-}
-
-// m49Index gives indexes into fromM49 based on the three most significant bits
-// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
-//    fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
-// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
-// The region code is stored in the 9 lsb of the indexed value.
-// Size: 18 bytes, 9 elements
-var m49Index = [9]int16{
-	0, 59, 108, 143, 181, 220, 259, 291,
-	333,
-}
-
-// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
-// Size: 666 bytes, 333 elements
-var fromM49 = [333]uint16{
-	// Entry 0 - 3F
-	0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
-	0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
-	0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
-	0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
-	0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
-	0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
-	0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
-	0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
-	// Entry 40 - 7F
-	0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
-	0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
-	0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
-	0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
-	0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
-	0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
-	0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
-	0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
-	// Entry 80 - BF
-	0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
-	0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
-	0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
-	0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
-	0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
-	0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
-	0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
-	0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
-	// Entry C0 - FF
-	0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
-	0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
-	0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
-	0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
-	0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
-	0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
-	0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
-	0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
-	// Entry 100 - 13F
-	0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
-	0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
-	0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
-	0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
-	0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
-	0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
-	0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
-	0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
-	// Entry 140 - 17F
-	0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
-	0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
-}
-
-// Size: 1615 bytes
-var variantIndex = map[string]uint8{
-	"1606nict": 0x0,
-	"1694acad": 0x1,
-	"1901":     0x2,
-	"1959acad": 0x3,
-	"1994":     0x4d,
-	"1996":     0x4,
-	"abl1943":  0x5,
-	"akuapem":  0x6,
-	"alalc97":  0x4f,
-	"aluku":    0x7,
-	"ao1990":   0x8,
-	"arevela":  0x9,
-	"arevmda":  0xa,
-	"asante":   0xb,
-	"baku1926": 0xc,
-	"balanka":  0xd,
-	"barla":    0xe,
-	"basiceng": 0xf,
-	"bauddha":  0x10,
-	"biscayan": 0x11,
-	"biske":    0x48,
-	"bohoric":  0x12,
-	"boont":    0x13,
-	"colb1945": 0x14,
-	"cornu":    0x15,
-	"dajnko":   0x16,
-	"ekavsk":   0x17,
-	"emodeng":  0x18,
-	"fonipa":   0x50,
-	"fonnapa":  0x51,
-	"fonupa":   0x52,
-	"fonxsamp": 0x53,
-	"hepburn":  0x19,
-	"heploc":   0x4e,
-	"hognorsk": 0x1a,
-	"hsistemo": 0x1b,
-	"ijekavsk": 0x1c,
-	"itihasa":  0x1d,
-	"jauer":    0x1e,
-	"jyutping": 0x1f,
-	"kkcor":    0x20,
-	"kociewie": 0x21,
-	"kscor":    0x22,
-	"laukika":  0x23,
-	"lipaw":    0x49,
-	"luna1918": 0x24,
-	"metelko":  0x25,
-	"monoton":  0x26,
-	"ndyuka":   0x27,
-	"nedis":    0x28,
-	"newfound": 0x29,
-	"njiva":    0x4a,
-	"nulik":    0x2a,
-	"osojs":    0x4b,
-	"oxendict": 0x2b,
-	"pahawh2":  0x2c,
-	"pahawh3":  0x2d,
-	"pahawh4":  0x2e,
-	"pamaka":   0x2f,
-	"petr1708": 0x30,
-	"pinyin":   0x31,
-	"polyton":  0x32,
-	"puter":    0x33,
-	"rigik":    0x34,
-	"rozaj":    0x35,
-	"rumgr":    0x36,
-	"scotland": 0x37,
-	"scouse":   0x38,
-	"simple":   0x54,
-	"solba":    0x4c,
-	"sotav":    0x39,
-	"spanglis": 0x3a,
-	"surmiran": 0x3b,
-	"sursilv":  0x3c,
-	"sutsilv":  0x3d,
-	"tarask":   0x3e,
-	"uccor":    0x3f,
-	"ucrcor":   0x40,
-	"ulster":   0x41,
-	"unifon":   0x42,
-	"vaidika":  0x43,
-	"valencia": 0x44,
-	"vallader": 0x45,
-	"wadegile": 0x46,
-	"xsistemo": 0x47,
-}
-
-// variantNumSpecialized is the number of specialized variants in variants.
-const variantNumSpecialized = 79
-
-// nRegionGroups is the number of region groups.
-const nRegionGroups = 33
-
-type likelyLangRegion struct {
-	lang   uint16
-	region uint16
-}
-
-// likelyScript is a lookup table, indexed by scriptID, for the most likely
-// languages and regions given a script.
-// Size: 976 bytes, 244 elements
-var likelyScript = [244]likelyLangRegion{
-	1:   {lang: 0x14e, region: 0x84},
-	3:   {lang: 0x2a2, region: 0x106},
-	4:   {lang: 0x1f, region: 0x99},
-	5:   {lang: 0x3a, region: 0x6b},
-	7:   {lang: 0x3b, region: 0x9c},
-	8:   {lang: 0x1d7, region: 0x28},
-	9:   {lang: 0x13, region: 0x9c},
-	10:  {lang: 0x5b, region: 0x95},
-	11:  {lang: 0x60, region: 0x52},
-	12:  {lang: 0xb9, region: 0xb4},
-	13:  {lang: 0x63, region: 0x95},
-	14:  {lang: 0xa5, region: 0x35},
-	15:  {lang: 0x3e9, region: 0x99},
-	17:  {lang: 0x529, region: 0x12e},
-	18:  {lang: 0x3b1, region: 0x99},
-	19:  {lang: 0x15e, region: 0x78},
-	20:  {lang: 0xc2, region: 0x95},
-	21:  {lang: 0x9d, region: 0xe7},
-	22:  {lang: 0xdb, region: 0x35},
-	23:  {lang: 0xf3, region: 0x49},
-	24:  {lang: 0x4f0, region: 0x12b},
-	25:  {lang: 0xe7, region: 0x13e},
-	26:  {lang: 0xe5, region: 0x135},
-	28:  {lang: 0xf1, region: 0x6b},
-	30:  {lang: 0x1a0, region: 0x5d},
-	31:  {lang: 0x3e2, region: 0x106},
-	33:  {lang: 0x1be, region: 0x99},
-	36:  {lang: 0x15e, region: 0x78},
-	39:  {lang: 0x133, region: 0x6b},
-	40:  {lang: 0x431, region: 0x27},
-	41:  {lang: 0x27, region: 0x6f},
-	43:  {lang: 0x210, region: 0x7d},
-	44:  {lang: 0xfe, region: 0x38},
-	46:  {lang: 0x19b, region: 0x99},
-	47:  {lang: 0x19e, region: 0x130},
-	48:  {lang: 0x3e9, region: 0x99},
-	49:  {lang: 0x136, region: 0x87},
-	50:  {lang: 0x1a4, region: 0x99},
-	51:  {lang: 0x39d, region: 0x99},
-	52:  {lang: 0x529, region: 0x12e},
-	53:  {lang: 0x254, region: 0xab},
-	54:  {lang: 0x529, region: 0x53},
-	55:  {lang: 0x1cb, region: 0xe7},
-	56:  {lang: 0x529, region: 0x53},
-	57:  {lang: 0x529, region: 0x12e},
-	58:  {lang: 0x2fd, region: 0x9b},
-	59:  {lang: 0x1bc, region: 0x97},
-	60:  {lang: 0x200, region: 0xa2},
-	61:  {lang: 0x1c5, region: 0x12b},
-	62:  {lang: 0x1ca, region: 0xaf},
-	65:  {lang: 0x1d5, region: 0x92},
-	67:  {lang: 0x142, region: 0x9e},
-	68:  {lang: 0x254, region: 0xab},
-	69:  {lang: 0x20e, region: 0x95},
-	70:  {lang: 0x200, region: 0xa2},
-	72:  {lang: 0x135, region: 0xc4},
-	73:  {lang: 0x200, region: 0xa2},
-	74:  {lang: 0x3bb, region: 0xe8},
-	75:  {lang: 0x24a, region: 0xa6},
-	76:  {lang: 0x3fa, region: 0x99},
-	79:  {lang: 0x251, region: 0x99},
-	80:  {lang: 0x254, region: 0xab},
-	82:  {lang: 0x88, region: 0x99},
-	83:  {lang: 0x370, region: 0x123},
-	84:  {lang: 0x2b8, region: 0xaf},
-	89:  {lang: 0x29f, region: 0x99},
-	90:  {lang: 0x2a8, region: 0x99},
-	91:  {lang: 0x28f, region: 0x87},
-	92:  {lang: 0x1a0, region: 0x87},
-	93:  {lang: 0x2ac, region: 0x53},
-	95:  {lang: 0x4f4, region: 0x12b},
-	96:  {lang: 0x4f5, region: 0x12b},
-	97:  {lang: 0x1be, region: 0x99},
-	99:  {lang: 0x337, region: 0x9c},
-	100: {lang: 0x4f7, region: 0x53},
-	101: {lang: 0xa9, region: 0x53},
-	104: {lang: 0x2e8, region: 0x112},
-	105: {lang: 0x4f8, region: 0x10b},
-	106: {lang: 0x4f8, region: 0x10b},
-	107: {lang: 0x304, region: 0x99},
-	108: {lang: 0x31b, region: 0x99},
-	109: {lang: 0x30b, region: 0x53},
-	111: {lang: 0x31e, region: 0x35},
-	112: {lang: 0x30e, region: 0x99},
-	113: {lang: 0x414, region: 0xe8},
-	114: {lang: 0x331, region: 0xc4},
-	115: {lang: 0x4f9, region: 0x108},
-	116: {lang: 0x3b, region: 0xa1},
-	117: {lang: 0x353, region: 0xdb},
-	120: {lang: 0x2d0, region: 0x84},
-	121: {lang: 0x52a, region: 0x53},
-	122: {lang: 0x403, region: 0x96},
-	123: {lang: 0x3ee, region: 0x99},
-	124: {lang: 0x39b, region: 0xc5},
-	125: {lang: 0x395, region: 0x99},
-	126: {lang: 0x399, region: 0x135},
-	127: {lang: 0x429, region: 0x115},
-	128: {lang: 0x3b, region: 0x11c},
-	129: {lang: 0xfd, region: 0xc4},
-	130: {lang: 0x27d, region: 0x106},
-	131: {lang: 0x2c9, region: 0x53},
-	132: {lang: 0x39f, region: 0x9c},
-	133: {lang: 0x39f, region: 0x53},
-	135: {lang: 0x3ad, region: 0xb0},
-	137: {lang: 0x1c6, region: 0x53},
-	138: {lang: 0x4fd, region: 0x9c},
-	189: {lang: 0x3cb, region: 0x95},
-	191: {lang: 0x372, region: 0x10c},
-	192: {lang: 0x420, region: 0x97},
-	194: {lang: 0x4ff, region: 0x15e},
-	195: {lang: 0x3f0, region: 0x99},
-	196: {lang: 0x45, region: 0x135},
-	197: {lang: 0x139, region: 0x7b},
-	198: {lang: 0x3e9, region: 0x99},
-	200: {lang: 0x3e9, region: 0x99},
-	201: {lang: 0x3fa, region: 0x99},
-	202: {lang: 0x40c, region: 0xb3},
-	203: {lang: 0x433, region: 0x99},
-	204: {lang: 0xef, region: 0xc5},
-	205: {lang: 0x43e, region: 0x95},
-	206: {lang: 0x44d, region: 0x35},
-	207: {lang: 0x44e, region: 0x9b},
-	211: {lang: 0x45a, region: 0xe7},
-	212: {lang: 0x11a, region: 0x99},
-	213: {lang: 0x45e, region: 0x53},
-	214: {lang: 0x232, region: 0x53},
-	215: {lang: 0x450, region: 0x99},
-	216: {lang: 0x4a5, region: 0x53},
-	217: {lang: 0x9f, region: 0x13e},
-	218: {lang: 0x461, region: 0x99},
-	220: {lang: 0x528, region: 0xba},
-	221: {lang: 0x153, region: 0xe7},
-	222: {lang: 0x128, region: 0xcd},
-	223: {lang: 0x46b, region: 0x123},
-	224: {lang: 0xa9, region: 0x53},
-	225: {lang: 0x2ce, region: 0x99},
-	226: {lang: 0x4ad, region: 0x11c},
-	227: {lang: 0x4be, region: 0xb4},
-	229: {lang: 0x1ce, region: 0x99},
-	232: {lang: 0x3a9, region: 0x9c},
-	233: {lang: 0x22, region: 0x9b},
-	234: {lang: 0x1ea, region: 0x53},
-	235: {lang: 0xef, region: 0xc5},
-}
-
-type likelyScriptRegion struct {
-	region uint16
-	script uint8
-	flags  uint8
-}
-
-// likelyLang is a lookup table, indexed by langID, for the most likely
-// scripts and regions given incomplete information. If more entries exist for a
-// given language, region and script are the index and size respectively
-// of the list in likelyLangList.
-// Size: 5320 bytes, 1330 elements
-var likelyLang = [1330]likelyScriptRegion{
-	0:    {region: 0x135, script: 0x57, flags: 0x0},
-	1:    {region: 0x6f, script: 0x57, flags: 0x0},
-	2:    {region: 0x165, script: 0x57, flags: 0x0},
-	3:    {region: 0x165, script: 0x57, flags: 0x0},
-	4:    {region: 0x165, script: 0x57, flags: 0x0},
-	5:    {region: 0x7d, script: 0x1f, flags: 0x0},
-	6:    {region: 0x165, script: 0x57, flags: 0x0},
-	7:    {region: 0x165, script: 0x1f, flags: 0x0},
-	8:    {region: 0x80, script: 0x57, flags: 0x0},
-	9:    {region: 0x165, script: 0x57, flags: 0x0},
-	10:   {region: 0x165, script: 0x57, flags: 0x0},
-	11:   {region: 0x165, script: 0x57, flags: 0x0},
-	12:   {region: 0x95, script: 0x57, flags: 0x0},
-	13:   {region: 0x131, script: 0x57, flags: 0x0},
-	14:   {region: 0x80, script: 0x57, flags: 0x0},
-	15:   {region: 0x165, script: 0x57, flags: 0x0},
-	16:   {region: 0x165, script: 0x57, flags: 0x0},
-	17:   {region: 0x106, script: 0x1f, flags: 0x0},
-	18:   {region: 0x165, script: 0x57, flags: 0x0},
-	19:   {region: 0x9c, script: 0x9, flags: 0x0},
-	20:   {region: 0x128, script: 0x5, flags: 0x0},
-	21:   {region: 0x165, script: 0x57, flags: 0x0},
-	22:   {region: 0x161, script: 0x57, flags: 0x0},
-	23:   {region: 0x165, script: 0x57, flags: 0x0},
-	24:   {region: 0x165, script: 0x57, flags: 0x0},
-	25:   {region: 0x165, script: 0x57, flags: 0x0},
-	26:   {region: 0x165, script: 0x57, flags: 0x0},
-	27:   {region: 0x165, script: 0x57, flags: 0x0},
-	28:   {region: 0x52, script: 0x57, flags: 0x0},
-	29:   {region: 0x165, script: 0x57, flags: 0x0},
-	30:   {region: 0x165, script: 0x57, flags: 0x0},
-	31:   {region: 0x99, script: 0x4, flags: 0x0},
-	32:   {region: 0x165, script: 0x57, flags: 0x0},
-	33:   {region: 0x80, script: 0x57, flags: 0x0},
-	34:   {region: 0x9b, script: 0xe9, flags: 0x0},
-	35:   {region: 0x165, script: 0x57, flags: 0x0},
-	36:   {region: 0x165, script: 0x57, flags: 0x0},
-	37:   {region: 0x14d, script: 0x57, flags: 0x0},
-	38:   {region: 0x106, script: 0x1f, flags: 0x0},
-	39:   {region: 0x6f, script: 0x29, flags: 0x0},
-	40:   {region: 0x165, script: 0x57, flags: 0x0},
-	41:   {region: 0x165, script: 0x57, flags: 0x0},
-	42:   {region: 0xd6, script: 0x57, flags: 0x0},
-	43:   {region: 0x165, script: 0x57, flags: 0x0},
-	45:   {region: 0x165, script: 0x57, flags: 0x0},
-	46:   {region: 0x165, script: 0x57, flags: 0x0},
-	47:   {region: 0x165, script: 0x57, flags: 0x0},
-	48:   {region: 0x165, script: 0x57, flags: 0x0},
-	49:   {region: 0x165, script: 0x57, flags: 0x0},
-	50:   {region: 0x165, script: 0x57, flags: 0x0},
-	51:   {region: 0x95, script: 0x57, flags: 0x0},
-	52:   {region: 0x165, script: 0x5, flags: 0x0},
-	53:   {region: 0x122, script: 0x5, flags: 0x0},
-	54:   {region: 0x165, script: 0x57, flags: 0x0},
-	55:   {region: 0x165, script: 0x57, flags: 0x0},
-	56:   {region: 0x165, script: 0x57, flags: 0x0},
-	57:   {region: 0x165, script: 0x57, flags: 0x0},
-	58:   {region: 0x6b, script: 0x5, flags: 0x0},
-	59:   {region: 0x0, script: 0x3, flags: 0x1},
-	60:   {region: 0x165, script: 0x57, flags: 0x0},
-	61:   {region: 0x51, script: 0x57, flags: 0x0},
-	62:   {region: 0x3f, script: 0x57, flags: 0x0},
-	63:   {region: 0x67, script: 0x5, flags: 0x0},
-	65:   {region: 0xba, script: 0x5, flags: 0x0},
-	66:   {region: 0x6b, script: 0x5, flags: 0x0},
-	67:   {region: 0x99, script: 0xe, flags: 0x0},
-	68:   {region: 0x12f, script: 0x57, flags: 0x0},
-	69:   {region: 0x135, script: 0xc4, flags: 0x0},
-	70:   {region: 0x165, script: 0x57, flags: 0x0},
-	71:   {region: 0x165, script: 0x57, flags: 0x0},
-	72:   {region: 0x6e, script: 0x57, flags: 0x0},
-	73:   {region: 0x165, script: 0x57, flags: 0x0},
-	74:   {region: 0x165, script: 0x57, flags: 0x0},
-	75:   {region: 0x49, script: 0x57, flags: 0x0},
-	76:   {region: 0x165, script: 0x57, flags: 0x0},
-	77:   {region: 0x106, script: 0x1f, flags: 0x0},
-	78:   {region: 0x165, script: 0x5, flags: 0x0},
-	79:   {region: 0x165, script: 0x57, flags: 0x0},
-	80:   {region: 0x165, script: 0x57, flags: 0x0},
-	81:   {region: 0x165, script: 0x57, flags: 0x0},
-	82:   {region: 0x99, script: 0x21, flags: 0x0},
-	83:   {region: 0x165, script: 0x57, flags: 0x0},
-	84:   {region: 0x165, script: 0x57, flags: 0x0},
-	85:   {region: 0x165, script: 0x57, flags: 0x0},
-	86:   {region: 0x3f, script: 0x57, flags: 0x0},
-	87:   {region: 0x165, script: 0x57, flags: 0x0},
-	88:   {region: 0x3, script: 0x5, flags: 0x1},
-	89:   {region: 0x106, script: 0x1f, flags: 0x0},
-	90:   {region: 0xe8, script: 0x5, flags: 0x0},
-	91:   {region: 0x95, script: 0x57, flags: 0x0},
-	92:   {region: 0xdb, script: 0x21, flags: 0x0},
-	93:   {region: 0x2e, script: 0x57, flags: 0x0},
-	94:   {region: 0x52, script: 0x57, flags: 0x0},
-	95:   {region: 0x165, script: 0x57, flags: 0x0},
-	96:   {region: 0x52, script: 0xb, flags: 0x0},
-	97:   {region: 0x165, script: 0x57, flags: 0x0},
-	98:   {region: 0x165, script: 0x57, flags: 0x0},
-	99:   {region: 0x95, script: 0x57, flags: 0x0},
-	100:  {region: 0x165, script: 0x57, flags: 0x0},
-	101:  {region: 0x52, script: 0x57, flags: 0x0},
-	102:  {region: 0x165, script: 0x57, flags: 0x0},
-	103:  {region: 0x165, script: 0x57, flags: 0x0},
-	104:  {region: 0x165, script: 0x57, flags: 0x0},
-	105:  {region: 0x165, script: 0x57, flags: 0x0},
-	106:  {region: 0x4f, script: 0x57, flags: 0x0},
-	107:  {region: 0x165, script: 0x57, flags: 0x0},
-	108:  {region: 0x165, script: 0x57, flags: 0x0},
-	109:  {region: 0x165, script: 0x57, flags: 0x0},
-	110:  {region: 0x165, script: 0x29, flags: 0x0},
-	111:  {region: 0x165, script: 0x57, flags: 0x0},
-	112:  {region: 0x165, script: 0x57, flags: 0x0},
-	113:  {region: 0x47, script: 0x1f, flags: 0x0},
-	114:  {region: 0x165, script: 0x57, flags: 0x0},
-	115:  {region: 0x165, script: 0x57, flags: 0x0},
-	116:  {region: 0x10b, script: 0x5, flags: 0x0},
-	117:  {region: 0x162, script: 0x57, flags: 0x0},
-	118:  {region: 0x165, script: 0x57, flags: 0x0},
-	119:  {region: 0x95, script: 0x57, flags: 0x0},
-	120:  {region: 0x165, script: 0x57, flags: 0x0},
-	121:  {region: 0x12f, script: 0x57, flags: 0x0},
-	122:  {region: 0x52, script: 0x57, flags: 0x0},
-	123:  {region: 0x99, script: 0xd7, flags: 0x0},
-	124:  {region: 0xe8, script: 0x5, flags: 0x0},
-	125:  {region: 0x99, script: 0x21, flags: 0x0},
-	126:  {region: 0x38, script: 0x1f, flags: 0x0},
-	127:  {region: 0x99, script: 0x21, flags: 0x0},
-	128:  {region: 0xe8, script: 0x5, flags: 0x0},
-	129:  {region: 0x12b, script: 0x31, flags: 0x0},
-	131:  {region: 0x99, script: 0x21, flags: 0x0},
-	132:  {region: 0x165, script: 0x57, flags: 0x0},
-	133:  {region: 0x99, script: 0x21, flags: 0x0},
-	134:  {region: 0xe7, script: 0x57, flags: 0x0},
-	135:  {region: 0x165, script: 0x57, flags: 0x0},
-	136:  {region: 0x99, script: 0x21, flags: 0x0},
-	137:  {region: 0x165, script: 0x57, flags: 0x0},
-	138:  {region: 0x13f, script: 0x57, flags: 0x0},
-	139:  {region: 0x165, script: 0x57, flags: 0x0},
-	140:  {region: 0x165, script: 0x57, flags: 0x0},
-	141:  {region: 0xe7, script: 0x57, flags: 0x0},
-	142:  {region: 0x165, script: 0x57, flags: 0x0},
-	143:  {region: 0xd6, script: 0x57, flags: 0x0},
-	144:  {region: 0x165, script: 0x57, flags: 0x0},
-	145:  {region: 0x165, script: 0x57, flags: 0x0},
-	146:  {region: 0x165, script: 0x57, flags: 0x0},
-	147:  {region: 0x165, script: 0x29, flags: 0x0},
-	148:  {region: 0x99, script: 0x21, flags: 0x0},
-	149:  {region: 0x95, script: 0x57, flags: 0x0},
-	150:  {region: 0x165, script: 0x57, flags: 0x0},
-	151:  {region: 0x165, script: 0x57, flags: 0x0},
-	152:  {region: 0x114, script: 0x57, flags: 0x0},
-	153:  {region: 0x165, script: 0x57, flags: 0x0},
-	154:  {region: 0x165, script: 0x57, flags: 0x0},
-	155:  {region: 0x52, script: 0x57, flags: 0x0},
-	156:  {region: 0x165, script: 0x57, flags: 0x0},
-	157:  {region: 0xe7, script: 0x57, flags: 0x0},
-	158:  {region: 0x165, script: 0x57, flags: 0x0},
-	159:  {region: 0x13e, script: 0xd9, flags: 0x0},
-	160:  {region: 0xc3, script: 0x57, flags: 0x0},
-	161:  {region: 0x165, script: 0x57, flags: 0x0},
-	162:  {region: 0x165, script: 0x57, flags: 0x0},
-	163:  {region: 0xc3, script: 0x57, flags: 0x0},
-	164:  {region: 0x165, script: 0x57, flags: 0x0},
-	165:  {region: 0x35, script: 0xe, flags: 0x0},
-	166:  {region: 0x165, script: 0x57, flags: 0x0},
-	167:  {region: 0x165, script: 0x57, flags: 0x0},
-	168:  {region: 0x165, script: 0x57, flags: 0x0},
-	169:  {region: 0x53, script: 0xe0, flags: 0x0},
-	170:  {region: 0x165, script: 0x57, flags: 0x0},
-	171:  {region: 0x165, script: 0x57, flags: 0x0},
-	172:  {region: 0x165, script: 0x57, flags: 0x0},
-	173:  {region: 0x99, script: 0xe, flags: 0x0},
-	174:  {region: 0x165, script: 0x57, flags: 0x0},
-	175:  {region: 0x9c, script: 0x5, flags: 0x0},
-	176:  {region: 0x165, script: 0x57, flags: 0x0},
-	177:  {region: 0x4f, script: 0x57, flags: 0x0},
-	178:  {region: 0x78, script: 0x57, flags: 0x0},
-	179:  {region: 0x99, script: 0x21, flags: 0x0},
-	180:  {region: 0xe8, script: 0x5, flags: 0x0},
-	181:  {region: 0x99, script: 0x21, flags: 0x0},
-	182:  {region: 0x165, script: 0x57, flags: 0x0},
-	183:  {region: 0x33, script: 0x57, flags: 0x0},
-	184:  {region: 0x165, script: 0x57, flags: 0x0},
-	185:  {region: 0xb4, script: 0xc, flags: 0x0},
-	186:  {region: 0x52, script: 0x57, flags: 0x0},
-	187:  {region: 0x165, script: 0x29, flags: 0x0},
-	188:  {region: 0xe7, script: 0x57, flags: 0x0},
-	189:  {region: 0x165, script: 0x57, flags: 0x0},
-	190:  {region: 0xe8, script: 0x21, flags: 0x0},
-	191:  {region: 0x106, script: 0x1f, flags: 0x0},
-	192:  {region: 0x15f, script: 0x57, flags: 0x0},
-	193:  {region: 0x165, script: 0x57, flags: 0x0},
-	194:  {region: 0x95, script: 0x57, flags: 0x0},
-	195:  {region: 0x165, script: 0x57, flags: 0x0},
-	196:  {region: 0x52, script: 0x57, flags: 0x0},
-	197:  {region: 0x165, script: 0x57, flags: 0x0},
-	198:  {region: 0x165, script: 0x57, flags: 0x0},
-	199:  {region: 0x165, script: 0x57, flags: 0x0},
-	200:  {region: 0x86, script: 0x57, flags: 0x0},
-	201:  {region: 0x165, script: 0x57, flags: 0x0},
-	202:  {region: 0x165, script: 0x57, flags: 0x0},
-	203:  {region: 0x165, script: 0x57, flags: 0x0},
-	204:  {region: 0x165, script: 0x57, flags: 0x0},
-	205:  {region: 0x6d, script: 0x29, flags: 0x0},
-	206:  {region: 0x165, script: 0x57, flags: 0x0},
-	207:  {region: 0x165, script: 0x57, flags: 0x0},
-	208:  {region: 0x52, script: 0x57, flags: 0x0},
-	209:  {region: 0x165, script: 0x57, flags: 0x0},
-	210:  {region: 0x165, script: 0x57, flags: 0x0},
-	211:  {region: 0xc3, script: 0x57, flags: 0x0},
-	212:  {region: 0x165, script: 0x57, flags: 0x0},
-	213:  {region: 0x165, script: 0x57, flags: 0x0},
-	214:  {region: 0x165, script: 0x57, flags: 0x0},
-	215:  {region: 0x6e, script: 0x57, flags: 0x0},
-	216:  {region: 0x165, script: 0x57, flags: 0x0},
-	217:  {region: 0x165, script: 0x57, flags: 0x0},
-	218:  {region: 0xd6, script: 0x57, flags: 0x0},
-	219:  {region: 0x35, script: 0x16, flags: 0x0},
-	220:  {region: 0x106, script: 0x1f, flags: 0x0},
-	221:  {region: 0xe7, script: 0x57, flags: 0x0},
-	222:  {region: 0x165, script: 0x57, flags: 0x0},
-	223:  {region: 0x131, script: 0x57, flags: 0x0},
-	224:  {region: 0x8a, script: 0x57, flags: 0x0},
-	225:  {region: 0x75, script: 0x57, flags: 0x0},
-	226:  {region: 0x106, script: 0x1f, flags: 0x0},
-	227:  {region: 0x135, script: 0x57, flags: 0x0},
-	228:  {region: 0x49, script: 0x57, flags: 0x0},
-	229:  {region: 0x135, script: 0x1a, flags: 0x0},
-	230:  {region: 0xa6, script: 0x5, flags: 0x0},
-	231:  {region: 0x13e, script: 0x19, flags: 0x0},
-	232:  {region: 0x165, script: 0x57, flags: 0x0},
-	233:  {region: 0x9b, script: 0x5, flags: 0x0},
-	234:  {region: 0x165, script: 0x57, flags: 0x0},
-	235:  {region: 0x165, script: 0x57, flags: 0x0},
-	236:  {region: 0x165, script: 0x57, flags: 0x0},
-	237:  {region: 0x165, script: 0x57, flags: 0x0},
-	238:  {region: 0x165, script: 0x57, flags: 0x0},
-	239:  {region: 0xc5, script: 0xcc, flags: 0x0},
-	240:  {region: 0x78, script: 0x57, flags: 0x0},
-	241:  {region: 0x6b, script: 0x1c, flags: 0x0},
-	242:  {region: 0xe7, script: 0x57, flags: 0x0},
-	243:  {region: 0x49, script: 0x17, flags: 0x0},
-	244:  {region: 0x130, script: 0x1f, flags: 0x0},
-	245:  {region: 0x49, script: 0x17, flags: 0x0},
-	246:  {region: 0x49, script: 0x17, flags: 0x0},
-	247:  {region: 0x49, script: 0x17, flags: 0x0},
-	248:  {region: 0x49, script: 0x17, flags: 0x0},
-	249:  {region: 0x10a, script: 0x57, flags: 0x0},
-	250:  {region: 0x5e, script: 0x57, flags: 0x0},
-	251:  {region: 0xe9, script: 0x57, flags: 0x0},
-	252:  {region: 0x49, script: 0x17, flags: 0x0},
-	253:  {region: 0xc4, script: 0x81, flags: 0x0},
-	254:  {region: 0x8, script: 0x2, flags: 0x1},
-	255:  {region: 0x106, script: 0x1f, flags: 0x0},
-	256:  {region: 0x7b, script: 0x57, flags: 0x0},
-	257:  {region: 0x63, script: 0x57, flags: 0x0},
-	258:  {region: 0x165, script: 0x57, flags: 0x0},
-	259:  {region: 0x165, script: 0x57, flags: 0x0},
-	260:  {region: 0x165, script: 0x57, flags: 0x0},
-	261:  {region: 0x165, script: 0x57, flags: 0x0},
-	262:  {region: 0x135, script: 0x57, flags: 0x0},
-	263:  {region: 0x106, script: 0x1f, flags: 0x0},
-	264:  {region: 0xa4, script: 0x57, flags: 0x0},
-	265:  {region: 0x165, script: 0x57, flags: 0x0},
-	266:  {region: 0x165, script: 0x57, flags: 0x0},
-	267:  {region: 0x99, script: 0x5, flags: 0x0},
-	268:  {region: 0x165, script: 0x57, flags: 0x0},
-	269:  {region: 0x60, script: 0x57, flags: 0x0},
-	270:  {region: 0x165, script: 0x57, flags: 0x0},
-	271:  {region: 0x49, script: 0x57, flags: 0x0},
-	272:  {region: 0x165, script: 0x57, flags: 0x0},
-	273:  {region: 0x165, script: 0x57, flags: 0x0},
-	274:  {region: 0x165, script: 0x57, flags: 0x0},
-	275:  {region: 0x165, script: 0x5, flags: 0x0},
-	276:  {region: 0x49, script: 0x57, flags: 0x0},
-	277:  {region: 0x165, script: 0x57, flags: 0x0},
-	278:  {region: 0x165, script: 0x57, flags: 0x0},
-	279:  {region: 0xd4, script: 0x57, flags: 0x0},
-	280:  {region: 0x4f, script: 0x57, flags: 0x0},
-	281:  {region: 0x165, script: 0x57, flags: 0x0},
-	282:  {region: 0x99, script: 0x5, flags: 0x0},
-	283:  {region: 0x165, script: 0x57, flags: 0x0},
-	284:  {region: 0x165, script: 0x57, flags: 0x0},
-	285:  {region: 0x165, script: 0x57, flags: 0x0},
-	286:  {region: 0x165, script: 0x29, flags: 0x0},
-	287:  {region: 0x60, script: 0x57, flags: 0x0},
-	288:  {region: 0xc3, script: 0x57, flags: 0x0},
-	289:  {region: 0xd0, script: 0x57, flags: 0x0},
-	290:  {region: 0x165, script: 0x57, flags: 0x0},
-	291:  {region: 0xdb, script: 0x21, flags: 0x0},
-	292:  {region: 0x52, script: 0x57, flags: 0x0},
-	293:  {region: 0x165, script: 0x57, flags: 0x0},
-	294:  {region: 0x165, script: 0x57, flags: 0x0},
-	295:  {region: 0x165, script: 0x57, flags: 0x0},
-	296:  {region: 0xcd, script: 0xde, flags: 0x0},
-	297:  {region: 0x165, script: 0x57, flags: 0x0},
-	298:  {region: 0x165, script: 0x57, flags: 0x0},
-	299:  {region: 0x114, script: 0x57, flags: 0x0},
-	300:  {region: 0x37, script: 0x57, flags: 0x0},
-	301:  {region: 0x43, script: 0xe0, flags: 0x0},
-	302:  {region: 0x165, script: 0x57, flags: 0x0},
-	303:  {region: 0xa4, script: 0x57, flags: 0x0},
-	304:  {region: 0x80, script: 0x57, flags: 0x0},
-	305:  {region: 0xd6, script: 0x57, flags: 0x0},
-	306:  {region: 0x9e, script: 0x57, flags: 0x0},
-	307:  {region: 0x6b, script: 0x27, flags: 0x0},
-	308:  {region: 0x165, script: 0x57, flags: 0x0},
-	309:  {region: 0xc4, script: 0x48, flags: 0x0},
-	310:  {region: 0x87, script: 0x31, flags: 0x0},
-	311:  {region: 0x165, script: 0x57, flags: 0x0},
-	312:  {region: 0x165, script: 0x57, flags: 0x0},
-	313:  {region: 0xa, script: 0x2, flags: 0x1},
-	314:  {region: 0x165, script: 0x57, flags: 0x0},
-	315:  {region: 0x165, script: 0x57, flags: 0x0},
-	316:  {region: 0x1, script: 0x57, flags: 0x0},
-	317:  {region: 0x165, script: 0x57, flags: 0x0},
-	318:  {region: 0x6e, script: 0x57, flags: 0x0},
-	319:  {region: 0x135, script: 0x57, flags: 0x0},
-	320:  {region: 0x6a, script: 0x57, flags: 0x0},
-	321:  {region: 0x165, script: 0x57, flags: 0x0},
-	322:  {region: 0x9e, script: 0x43, flags: 0x0},
-	323:  {region: 0x165, script: 0x57, flags: 0x0},
-	324:  {region: 0x165, script: 0x57, flags: 0x0},
-	325:  {region: 0x6e, script: 0x57, flags: 0x0},
-	326:  {region: 0x52, script: 0x57, flags: 0x0},
-	327:  {region: 0x6e, script: 0x57, flags: 0x0},
-	328:  {region: 0x9c, script: 0x5, flags: 0x0},
-	329:  {region: 0x165, script: 0x57, flags: 0x0},
-	330:  {region: 0x165, script: 0x57, flags: 0x0},
-	331:  {region: 0x165, script: 0x57, flags: 0x0},
-	332:  {region: 0x165, script: 0x57, flags: 0x0},
-	333:  {region: 0x86, script: 0x57, flags: 0x0},
-	334:  {region: 0xc, script: 0x2, flags: 0x1},
-	335:  {region: 0x165, script: 0x57, flags: 0x0},
-	336:  {region: 0xc3, script: 0x57, flags: 0x0},
-	337:  {region: 0x72, script: 0x57, flags: 0x0},
-	338:  {region: 0x10b, script: 0x5, flags: 0x0},
-	339:  {region: 0xe7, script: 0x57, flags: 0x0},
-	340:  {region: 0x10c, script: 0x57, flags: 0x0},
-	341:  {region: 0x73, script: 0x57, flags: 0x0},
-	342:  {region: 0x165, script: 0x57, flags: 0x0},
-	343:  {region: 0x165, script: 0x57, flags: 0x0},
-	344:  {region: 0x76, script: 0x57, flags: 0x0},
-	345:  {region: 0x165, script: 0x57, flags: 0x0},
-	346:  {region: 0x3b, script: 0x57, flags: 0x0},
-	347:  {region: 0x165, script: 0x57, flags: 0x0},
-	348:  {region: 0x165, script: 0x57, flags: 0x0},
-	349:  {region: 0x165, script: 0x57, flags: 0x0},
-	350:  {region: 0x78, script: 0x57, flags: 0x0},
-	351:  {region: 0x135, script: 0x57, flags: 0x0},
-	352:  {region: 0x78, script: 0x57, flags: 0x0},
-	353:  {region: 0x60, script: 0x57, flags: 0x0},
-	354:  {region: 0x60, script: 0x57, flags: 0x0},
-	355:  {region: 0x52, script: 0x5, flags: 0x0},
-	356:  {region: 0x140, script: 0x57, flags: 0x0},
-	357:  {region: 0x165, script: 0x57, flags: 0x0},
-	358:  {region: 0x84, script: 0x57, flags: 0x0},
-	359:  {region: 0x165, script: 0x57, flags: 0x0},
-	360:  {region: 0xd4, script: 0x57, flags: 0x0},
-	361:  {region: 0x9e, script: 0x57, flags: 0x0},
-	362:  {region: 0xd6, script: 0x57, flags: 0x0},
-	363:  {region: 0x165, script: 0x57, flags: 0x0},
-	364:  {region: 0x10b, script: 0x57, flags: 0x0},
-	365:  {region: 0xd9, script: 0x57, flags: 0x0},
-	366:  {region: 0x96, script: 0x57, flags: 0x0},
-	367:  {region: 0x80, script: 0x57, flags: 0x0},
-	368:  {region: 0x165, script: 0x57, flags: 0x0},
-	369:  {region: 0xbc, script: 0x57, flags: 0x0},
-	370:  {region: 0x165, script: 0x57, flags: 0x0},
-	371:  {region: 0x165, script: 0x57, flags: 0x0},
-	372:  {region: 0x165, script: 0x57, flags: 0x0},
-	373:  {region: 0x53, script: 0x38, flags: 0x0},
-	374:  {region: 0x165, script: 0x57, flags: 0x0},
-	375:  {region: 0x95, script: 0x57, flags: 0x0},
-	376:  {region: 0x165, script: 0x57, flags: 0x0},
-	377:  {region: 0x165, script: 0x57, flags: 0x0},
-	378:  {region: 0x99, script: 0x21, flags: 0x0},
-	379:  {region: 0x165, script: 0x57, flags: 0x0},
-	380:  {region: 0x9c, script: 0x5, flags: 0x0},
-	381:  {region: 0x7e, script: 0x57, flags: 0x0},
-	382:  {region: 0x7b, script: 0x57, flags: 0x0},
-	383:  {region: 0x165, script: 0x57, flags: 0x0},
-	384:  {region: 0x165, script: 0x57, flags: 0x0},
-	385:  {region: 0x165, script: 0x57, flags: 0x0},
-	386:  {region: 0x165, script: 0x57, flags: 0x0},
-	387:  {region: 0x165, script: 0x57, flags: 0x0},
-	388:  {region: 0x165, script: 0x57, flags: 0x0},
-	389:  {region: 0x6f, script: 0x29, flags: 0x0},
-	390:  {region: 0x165, script: 0x57, flags: 0x0},
-	391:  {region: 0xdb, script: 0x21, flags: 0x0},
-	392:  {region: 0x165, script: 0x57, flags: 0x0},
-	393:  {region: 0xa7, script: 0x57, flags: 0x0},
-	394:  {region: 0x165, script: 0x57, flags: 0x0},
-	395:  {region: 0xe8, script: 0x5, flags: 0x0},
-	396:  {region: 0x165, script: 0x57, flags: 0x0},
-	397:  {region: 0xe8, script: 0x5, flags: 0x0},
-	398:  {region: 0x165, script: 0x57, flags: 0x0},
-	399:  {region: 0x165, script: 0x57, flags: 0x0},
-	400:  {region: 0x6e, script: 0x57, flags: 0x0},
-	401:  {region: 0x9c, script: 0x5, flags: 0x0},
-	402:  {region: 0x165, script: 0x57, flags: 0x0},
-	403:  {region: 0x165, script: 0x29, flags: 0x0},
-	404:  {region: 0xf1, script: 0x57, flags: 0x0},
-	405:  {region: 0x165, script: 0x57, flags: 0x0},
-	406:  {region: 0x165, script: 0x57, flags: 0x0},
-	407:  {region: 0x165, script: 0x57, flags: 0x0},
-	408:  {region: 0x165, script: 0x29, flags: 0x0},
-	409:  {region: 0x165, script: 0x57, flags: 0x0},
-	410:  {region: 0x99, script: 0x21, flags: 0x0},
-	411:  {region: 0x99, script: 0xda, flags: 0x0},
-	412:  {region: 0x95, script: 0x57, flags: 0x0},
-	413:  {region: 0xd9, script: 0x57, flags: 0x0},
-	414:  {region: 0x130, script: 0x2f, flags: 0x0},
-	415:  {region: 0x165, script: 0x57, flags: 0x0},
-	416:  {region: 0xe, script: 0x2, flags: 0x1},
-	417:  {region: 0x99, script: 0xe, flags: 0x0},
-	418:  {region: 0x165, script: 0x57, flags: 0x0},
-	419:  {region: 0x4e, script: 0x57, flags: 0x0},
-	420:  {region: 0x99, script: 0x32, flags: 0x0},
-	421:  {region: 0x41, script: 0x57, flags: 0x0},
-	422:  {region: 0x54, script: 0x57, flags: 0x0},
-	423:  {region: 0x165, script: 0x57, flags: 0x0},
-	424:  {region: 0x80, script: 0x57, flags: 0x0},
-	425:  {region: 0x165, script: 0x57, flags: 0x0},
-	426:  {region: 0x165, script: 0x57, flags: 0x0},
-	427:  {region: 0xa4, script: 0x57, flags: 0x0},
-	428:  {region: 0x98, script: 0x57, flags: 0x0},
-	429:  {region: 0x165, script: 0x57, flags: 0x0},
-	430:  {region: 0xdb, script: 0x21, flags: 0x0},
-	431:  {region: 0x165, script: 0x57, flags: 0x0},
-	432:  {region: 0x165, script: 0x5, flags: 0x0},
-	433:  {region: 0x49, script: 0x57, flags: 0x0},
-	434:  {region: 0x165, script: 0x5, flags: 0x0},
-	435:  {region: 0x165, script: 0x57, flags: 0x0},
-	436:  {region: 0x10, script: 0x3, flags: 0x1},
-	437:  {region: 0x165, script: 0x57, flags: 0x0},
-	438:  {region: 0x53, script: 0x38, flags: 0x0},
-	439:  {region: 0x165, script: 0x57, flags: 0x0},
-	440:  {region: 0x135, script: 0x57, flags: 0x0},
-	441:  {region: 0x24, script: 0x5, flags: 0x0},
-	442:  {region: 0x165, script: 0x57, flags: 0x0},
-	443:  {region: 0x165, script: 0x29, flags: 0x0},
-	444:  {region: 0x97, script: 0x3b, flags: 0x0},
-	445:  {region: 0x165, script: 0x57, flags: 0x0},
-	446:  {region: 0x99, script: 0x21, flags: 0x0},
-	447:  {region: 0x165, script: 0x57, flags: 0x0},
-	448:  {region: 0x73, script: 0x57, flags: 0x0},
-	449:  {region: 0x165, script: 0x57, flags: 0x0},
-	450:  {region: 0x165, script: 0x57, flags: 0x0},
-	451:  {region: 0xe7, script: 0x57, flags: 0x0},
-	452:  {region: 0x165, script: 0x57, flags: 0x0},
-	453:  {region: 0x12b, script: 0x3d, flags: 0x0},
-	454:  {region: 0x53, script: 0x89, flags: 0x0},
-	455:  {region: 0x165, script: 0x57, flags: 0x0},
-	456:  {region: 0xe8, script: 0x5, flags: 0x0},
-	457:  {region: 0x99, script: 0x21, flags: 0x0},
-	458:  {region: 0xaf, script: 0x3e, flags: 0x0},
-	459:  {region: 0xe7, script: 0x57, flags: 0x0},
-	460:  {region: 0xe8, script: 0x5, flags: 0x0},
-	461:  {region: 0xe6, script: 0x57, flags: 0x0},
-	462:  {region: 0x99, script: 0x21, flags: 0x0},
-	463:  {region: 0x99, script: 0x21, flags: 0x0},
-	464:  {region: 0x165, script: 0x57, flags: 0x0},
-	465:  {region: 0x90, script: 0x57, flags: 0x0},
-	466:  {region: 0x60, script: 0x57, flags: 0x0},
-	467:  {region: 0x53, script: 0x38, flags: 0x0},
-	468:  {region: 0x91, script: 0x57, flags: 0x0},
-	469:  {region: 0x92, script: 0x57, flags: 0x0},
-	470:  {region: 0x165, script: 0x57, flags: 0x0},
-	471:  {region: 0x28, script: 0x8, flags: 0x0},
-	472:  {region: 0xd2, script: 0x57, flags: 0x0},
-	473:  {region: 0x78, script: 0x57, flags: 0x0},
-	474:  {region: 0x165, script: 0x57, flags: 0x0},
-	475:  {region: 0x165, script: 0x57, flags: 0x0},
-	476:  {region: 0xd0, script: 0x57, flags: 0x0},
-	477:  {region: 0xd6, script: 0x57, flags: 0x0},
-	478:  {region: 0x165, script: 0x57, flags: 0x0},
-	479:  {region: 0x165, script: 0x57, flags: 0x0},
-	480:  {region: 0x165, script: 0x57, flags: 0x0},
-	481:  {region: 0x95, script: 0x57, flags: 0x0},
-	482:  {region: 0x165, script: 0x57, flags: 0x0},
-	483:  {region: 0x165, script: 0x57, flags: 0x0},
-	484:  {region: 0x165, script: 0x57, flags: 0x0},
-	486:  {region: 0x122, script: 0x57, flags: 0x0},
-	487:  {region: 0xd6, script: 0x57, flags: 0x0},
-	488:  {region: 0x165, script: 0x57, flags: 0x0},
-	489:  {region: 0x165, script: 0x57, flags: 0x0},
-	490:  {region: 0x53, script: 0xea, flags: 0x0},
-	491:  {region: 0x165, script: 0x57, flags: 0x0},
-	492:  {region: 0x135, script: 0x57, flags: 0x0},
-	493:  {region: 0x165, script: 0x57, flags: 0x0},
-	494:  {region: 0x49, script: 0x57, flags: 0x0},
-	495:  {region: 0x165, script: 0x57, flags: 0x0},
-	496:  {region: 0x165, script: 0x57, flags: 0x0},
-	497:  {region: 0xe7, script: 0x57, flags: 0x0},
-	498:  {region: 0x165, script: 0x57, flags: 0x0},
-	499:  {region: 0x95, script: 0x57, flags: 0x0},
-	500:  {region: 0x106, script: 0x1f, flags: 0x0},
-	501:  {region: 0x1, script: 0x57, flags: 0x0},
-	502:  {region: 0x165, script: 0x57, flags: 0x0},
-	503:  {region: 0x165, script: 0x57, flags: 0x0},
-	504:  {region: 0x9d, script: 0x57, flags: 0x0},
-	505:  {region: 0x9e, script: 0x57, flags: 0x0},
-	506:  {region: 0x49, script: 0x17, flags: 0x0},
-	507:  {region: 0x97, script: 0x3b, flags: 0x0},
-	508:  {region: 0x165, script: 0x57, flags: 0x0},
-	509:  {region: 0x165, script: 0x57, flags: 0x0},
-	510:  {region: 0x106, script: 0x57, flags: 0x0},
-	511:  {region: 0x165, script: 0x57, flags: 0x0},
-	512:  {region: 0xa2, script: 0x46, flags: 0x0},
-	513:  {region: 0x165, script: 0x57, flags: 0x0},
-	514:  {region: 0xa0, script: 0x57, flags: 0x0},
-	515:  {region: 0x1, script: 0x57, flags: 0x0},
-	516:  {region: 0x165, script: 0x57, flags: 0x0},
-	517:  {region: 0x165, script: 0x57, flags: 0x0},
-	518:  {region: 0x165, script: 0x57, flags: 0x0},
-	519:  {region: 0x52, script: 0x57, flags: 0x0},
-	520:  {region: 0x130, script: 0x3b, flags: 0x0},
-	521:  {region: 0x165, script: 0x57, flags: 0x0},
-	522:  {region: 0x12f, script: 0x57, flags: 0x0},
-	523:  {region: 0xdb, script: 0x21, flags: 0x0},
-	524:  {region: 0x165, script: 0x57, flags: 0x0},
-	525:  {region: 0x63, script: 0x57, flags: 0x0},
-	526:  {region: 0x95, script: 0x57, flags: 0x0},
-	527:  {region: 0x95, script: 0x57, flags: 0x0},
-	528:  {region: 0x7d, script: 0x2b, flags: 0x0},
-	529:  {region: 0x137, script: 0x1f, flags: 0x0},
-	530:  {region: 0x67, script: 0x57, flags: 0x0},
-	531:  {region: 0xc4, script: 0x57, flags: 0x0},
-	532:  {region: 0x165, script: 0x57, flags: 0x0},
-	533:  {region: 0x165, script: 0x57, flags: 0x0},
-	534:  {region: 0xd6, script: 0x57, flags: 0x0},
-	535:  {region: 0xa4, script: 0x57, flags: 0x0},
-	536:  {region: 0xc3, script: 0x57, flags: 0x0},
-	537:  {region: 0x106, script: 0x1f, flags: 0x0},
-	538:  {region: 0x165, script: 0x57, flags: 0x0},
-	539:  {region: 0x165, script: 0x57, flags: 0x0},
-	540:  {region: 0x165, script: 0x57, flags: 0x0},
-	541:  {region: 0x165, script: 0x57, flags: 0x0},
-	542:  {region: 0xd4, script: 0x5, flags: 0x0},
-	543:  {region: 0xd6, script: 0x57, flags: 0x0},
-	544:  {region: 0x164, script: 0x57, flags: 0x0},
-	545:  {region: 0x165, script: 0x57, flags: 0x0},
-	546:  {region: 0x165, script: 0x57, flags: 0x0},
-	547:  {region: 0x12f, script: 0x57, flags: 0x0},
-	548:  {region: 0x122, script: 0x5, flags: 0x0},
-	549:  {region: 0x165, script: 0x57, flags: 0x0},
-	550:  {region: 0x123, script: 0xdf, flags: 0x0},
-	551:  {region: 0x5a, script: 0x57, flags: 0x0},
-	552:  {region: 0x52, script: 0x57, flags: 0x0},
-	553:  {region: 0x165, script: 0x57, flags: 0x0},
-	554:  {region: 0x4f, script: 0x57, flags: 0x0},
-	555:  {region: 0x99, script: 0x21, flags: 0x0},
-	556:  {region: 0x99, script: 0x21, flags: 0x0},
-	557:  {region: 0x4b, script: 0x57, flags: 0x0},
-	558:  {region: 0x95, script: 0x57, flags: 0x0},
-	559:  {region: 0x165, script: 0x57, flags: 0x0},
-	560:  {region: 0x41, script: 0x57, flags: 0x0},
-	561:  {region: 0x99, script: 0x57, flags: 0x0},
-	562:  {region: 0x53, script: 0xd6, flags: 0x0},
-	563:  {region: 0x99, script: 0x21, flags: 0x0},
-	564:  {region: 0xc3, script: 0x57, flags: 0x0},
-	565:  {region: 0x165, script: 0x57, flags: 0x0},
-	566:  {region: 0x99, script: 0x72, flags: 0x0},
-	567:  {region: 0xe8, script: 0x5, flags: 0x0},
-	568:  {region: 0x165, script: 0x57, flags: 0x0},
-	569:  {region: 0xa4, script: 0x57, flags: 0x0},
-	570:  {region: 0x165, script: 0x57, flags: 0x0},
-	571:  {region: 0x12b, script: 0x57, flags: 0x0},
-	572:  {region: 0x165, script: 0x57, flags: 0x0},
-	573:  {region: 0xd2, script: 0x57, flags: 0x0},
-	574:  {region: 0x165, script: 0x57, flags: 0x0},
-	575:  {region: 0xaf, script: 0x54, flags: 0x0},
-	576:  {region: 0x165, script: 0x57, flags: 0x0},
-	577:  {region: 0x165, script: 0x57, flags: 0x0},
-	578:  {region: 0x13, script: 0x6, flags: 0x1},
-	579:  {region: 0x165, script: 0x57, flags: 0x0},
-	580:  {region: 0x52, script: 0x57, flags: 0x0},
-	581:  {region: 0x82, script: 0x57, flags: 0x0},
-	582:  {region: 0xa4, script: 0x57, flags: 0x0},
-	583:  {region: 0x165, script: 0x57, flags: 0x0},
-	584:  {region: 0x165, script: 0x57, flags: 0x0},
-	585:  {region: 0x165, script: 0x57, flags: 0x0},
-	586:  {region: 0xa6, script: 0x4b, flags: 0x0},
-	587:  {region: 0x2a, script: 0x57, flags: 0x0},
-	588:  {region: 0x165, script: 0x57, flags: 0x0},
-	589:  {region: 0x165, script: 0x57, flags: 0x0},
-	590:  {region: 0x165, script: 0x57, flags: 0x0},
-	591:  {region: 0x165, script: 0x57, flags: 0x0},
-	592:  {region: 0x165, script: 0x57, flags: 0x0},
-	593:  {region: 0x99, script: 0x4f, flags: 0x0},
-	594:  {region: 0x8b, script: 0x57, flags: 0x0},
-	595:  {region: 0x165, script: 0x57, flags: 0x0},
-	596:  {region: 0xab, script: 0x50, flags: 0x0},
-	597:  {region: 0x106, script: 0x1f, flags: 0x0},
-	598:  {region: 0x99, script: 0x21, flags: 0x0},
-	599:  {region: 0x165, script: 0x57, flags: 0x0},
-	600:  {region: 0x75, script: 0x57, flags: 0x0},
-	601:  {region: 0x165, script: 0x57, flags: 0x0},
-	602:  {region: 0xb4, script: 0x57, flags: 0x0},
-	603:  {region: 0x165, script: 0x57, flags: 0x0},
-	604:  {region: 0x165, script: 0x57, flags: 0x0},
-	605:  {region: 0x165, script: 0x57, flags: 0x0},
-	606:  {region: 0x165, script: 0x57, flags: 0x0},
-	607:  {region: 0x165, script: 0x57, flags: 0x0},
-	608:  {region: 0x165, script: 0x57, flags: 0x0},
-	609:  {region: 0x165, script: 0x57, flags: 0x0},
-	610:  {region: 0x165, script: 0x29, flags: 0x0},
-	611:  {region: 0x165, script: 0x57, flags: 0x0},
-	612:  {region: 0x106, script: 0x1f, flags: 0x0},
-	613:  {region: 0x112, script: 0x57, flags: 0x0},
-	614:  {region: 0xe7, script: 0x57, flags: 0x0},
-	615:  {region: 0x106, script: 0x57, flags: 0x0},
-	616:  {region: 0x165, script: 0x57, flags: 0x0},
-	617:  {region: 0x99, script: 0x21, flags: 0x0},
-	618:  {region: 0x99, script: 0x5, flags: 0x0},
-	619:  {region: 0x12f, script: 0x57, flags: 0x0},
-	620:  {region: 0x165, script: 0x57, flags: 0x0},
-	621:  {region: 0x52, script: 0x57, flags: 0x0},
-	622:  {region: 0x60, script: 0x57, flags: 0x0},
-	623:  {region: 0x165, script: 0x57, flags: 0x0},
-	624:  {region: 0x165, script: 0x57, flags: 0x0},
-	625:  {region: 0x165, script: 0x29, flags: 0x0},
-	626:  {region: 0x165, script: 0x57, flags: 0x0},
-	627:  {region: 0x165, script: 0x57, flags: 0x0},
-	628:  {region: 0x19, script: 0x3, flags: 0x1},
-	629:  {region: 0x165, script: 0x57, flags: 0x0},
-	630:  {region: 0x165, script: 0x57, flags: 0x0},
-	631:  {region: 0x165, script: 0x57, flags: 0x0},
-	632:  {region: 0x165, script: 0x57, flags: 0x0},
-	633:  {region: 0x106, script: 0x1f, flags: 0x0},
-	634:  {region: 0x165, script: 0x57, flags: 0x0},
-	635:  {region: 0x165, script: 0x57, flags: 0x0},
-	636:  {region: 0x165, script: 0x57, flags: 0x0},
-	637:  {region: 0x106, script: 0x1f, flags: 0x0},
-	638:  {region: 0x165, script: 0x57, flags: 0x0},
-	639:  {region: 0x95, script: 0x57, flags: 0x0},
-	640:  {region: 0xe8, script: 0x5, flags: 0x0},
-	641:  {region: 0x7b, script: 0x57, flags: 0x0},
-	642:  {region: 0x165, script: 0x57, flags: 0x0},
-	643:  {region: 0x165, script: 0x57, flags: 0x0},
-	644:  {region: 0x165, script: 0x57, flags: 0x0},
-	645:  {region: 0x165, script: 0x29, flags: 0x0},
-	646:  {region: 0x123, script: 0xdf, flags: 0x0},
-	647:  {region: 0xe8, script: 0x5, flags: 0x0},
-	648:  {region: 0x165, script: 0x57, flags: 0x0},
-	649:  {region: 0x165, script: 0x57, flags: 0x0},
-	650:  {region: 0x1c, script: 0x5, flags: 0x1},
-	651:  {region: 0x165, script: 0x57, flags: 0x0},
-	652:  {region: 0x165, script: 0x57, flags: 0x0},
-	653:  {region: 0x165, script: 0x57, flags: 0x0},
-	654:  {region: 0x138, script: 0x57, flags: 0x0},
-	655:  {region: 0x87, script: 0x5b, flags: 0x0},
-	656:  {region: 0x97, script: 0x3b, flags: 0x0},
-	657:  {region: 0x12f, script: 0x57, flags: 0x0},
-	658:  {region: 0xe8, script: 0x5, flags: 0x0},
-	659:  {region: 0x131, script: 0x57, flags: 0x0},
-	660:  {region: 0x165, script: 0x57, flags: 0x0},
-	661:  {region: 0xb7, script: 0x57, flags: 0x0},
-	662:  {region: 0x106, script: 0x1f, flags: 0x0},
-	663:  {region: 0x165, script: 0x57, flags: 0x0},
-	664:  {region: 0x95, script: 0x57, flags: 0x0},
-	665:  {region: 0x165, script: 0x57, flags: 0x0},
-	666:  {region: 0x53, script: 0xdf, flags: 0x0},
-	667:  {region: 0x165, script: 0x57, flags: 0x0},
-	668:  {region: 0x165, script: 0x57, flags: 0x0},
-	669:  {region: 0x165, script: 0x57, flags: 0x0},
-	670:  {region: 0x165, script: 0x57, flags: 0x0},
-	671:  {region: 0x99, script: 0x59, flags: 0x0},
-	672:  {region: 0x165, script: 0x57, flags: 0x0},
-	673:  {region: 0x165, script: 0x57, flags: 0x0},
-	674:  {region: 0x106, script: 0x1f, flags: 0x0},
-	675:  {region: 0x131, script: 0x57, flags: 0x0},
-	676:  {region: 0x165, script: 0x57, flags: 0x0},
-	677:  {region: 0xd9, script: 0x57, flags: 0x0},
-	678:  {region: 0x165, script: 0x57, flags: 0x0},
-	679:  {region: 0x165, script: 0x57, flags: 0x0},
-	680:  {region: 0x21, script: 0x2, flags: 0x1},
-	681:  {region: 0x165, script: 0x57, flags: 0x0},
-	682:  {region: 0x165, script: 0x57, flags: 0x0},
-	683:  {region: 0x9e, script: 0x57, flags: 0x0},
-	684:  {region: 0x53, script: 0x5d, flags: 0x0},
-	685:  {region: 0x95, script: 0x57, flags: 0x0},
-	686:  {region: 0x9c, script: 0x5, flags: 0x0},
-	687:  {region: 0x135, script: 0x57, flags: 0x0},
-	688:  {region: 0x165, script: 0x57, flags: 0x0},
-	689:  {region: 0x165, script: 0x57, flags: 0x0},
-	690:  {region: 0x99, script: 0xda, flags: 0x0},
-	691:  {region: 0x9e, script: 0x57, flags: 0x0},
-	692:  {region: 0x165, script: 0x57, flags: 0x0},
-	693:  {region: 0x4b, script: 0x57, flags: 0x0},
-	694:  {region: 0x165, script: 0x57, flags: 0x0},
-	695:  {region: 0x165, script: 0x57, flags: 0x0},
-	696:  {region: 0xaf, script: 0x54, flags: 0x0},
-	697:  {region: 0x165, script: 0x57, flags: 0x0},
-	698:  {region: 0x165, script: 0x57, flags: 0x0},
-	699:  {region: 0x4b, script: 0x57, flags: 0x0},
-	700:  {region: 0x165, script: 0x57, flags: 0x0},
-	701:  {region: 0x165, script: 0x57, flags: 0x0},
-	702:  {region: 0x162, script: 0x57, flags: 0x0},
-	703:  {region: 0x9c, script: 0x5, flags: 0x0},
-	704:  {region: 0xb6, script: 0x57, flags: 0x0},
-	705:  {region: 0xb8, script: 0x57, flags: 0x0},
-	706:  {region: 0x4b, script: 0x57, flags: 0x0},
-	707:  {region: 0x4b, script: 0x57, flags: 0x0},
-	708:  {region: 0xa4, script: 0x57, flags: 0x0},
-	709:  {region: 0xa4, script: 0x57, flags: 0x0},
-	710:  {region: 0x9c, script: 0x5, flags: 0x0},
-	711:  {region: 0xb8, script: 0x57, flags: 0x0},
-	712:  {region: 0x123, script: 0xdf, flags: 0x0},
-	713:  {region: 0x53, script: 0x38, flags: 0x0},
-	714:  {region: 0x12b, script: 0x57, flags: 0x0},
-	715:  {region: 0x95, script: 0x57, flags: 0x0},
-	716:  {region: 0x52, script: 0x57, flags: 0x0},
-	717:  {region: 0x99, script: 0x21, flags: 0x0},
-	718:  {region: 0x99, script: 0x21, flags: 0x0},
-	719:  {region: 0x95, script: 0x57, flags: 0x0},
-	720:  {region: 0x23, script: 0x3, flags: 0x1},
-	721:  {region: 0xa4, script: 0x57, flags: 0x0},
-	722:  {region: 0x165, script: 0x57, flags: 0x0},
-	723:  {region: 0xcf, script: 0x57, flags: 0x0},
-	724:  {region: 0x165, script: 0x57, flags: 0x0},
-	725:  {region: 0x165, script: 0x57, flags: 0x0},
-	726:  {region: 0x165, script: 0x57, flags: 0x0},
-	727:  {region: 0x165, script: 0x57, flags: 0x0},
-	728:  {region: 0x165, script: 0x57, flags: 0x0},
-	729:  {region: 0x165, script: 0x57, flags: 0x0},
-	730:  {region: 0x165, script: 0x57, flags: 0x0},
-	731:  {region: 0x165, script: 0x57, flags: 0x0},
-	732:  {region: 0x165, script: 0x57, flags: 0x0},
-	733:  {region: 0x165, script: 0x57, flags: 0x0},
-	734:  {region: 0x165, script: 0x57, flags: 0x0},
-	735:  {region: 0x165, script: 0x5, flags: 0x0},
-	736:  {region: 0x106, script: 0x1f, flags: 0x0},
-	737:  {region: 0xe7, script: 0x57, flags: 0x0},
-	738:  {region: 0x165, script: 0x57, flags: 0x0},
-	739:  {region: 0x95, script: 0x57, flags: 0x0},
-	740:  {region: 0x165, script: 0x29, flags: 0x0},
-	741:  {region: 0x165, script: 0x57, flags: 0x0},
-	742:  {region: 0x165, script: 0x57, flags: 0x0},
-	743:  {region: 0x165, script: 0x57, flags: 0x0},
-	744:  {region: 0x112, script: 0x57, flags: 0x0},
-	745:  {region: 0xa4, script: 0x57, flags: 0x0},
-	746:  {region: 0x165, script: 0x57, flags: 0x0},
-	747:  {region: 0x165, script: 0x57, flags: 0x0},
-	748:  {region: 0x123, script: 0x5, flags: 0x0},
-	749:  {region: 0xcc, script: 0x57, flags: 0x0},
-	750:  {region: 0x165, script: 0x57, flags: 0x0},
-	751:  {region: 0x165, script: 0x57, flags: 0x0},
-	752:  {region: 0x165, script: 0x57, flags: 0x0},
-	753:  {region: 0xbf, script: 0x57, flags: 0x0},
-	754:  {region: 0xd1, script: 0x57, flags: 0x0},
-	755:  {region: 0x165, script: 0x57, flags: 0x0},
-	756:  {region: 0x52, script: 0x57, flags: 0x0},
-	757:  {region: 0xdb, script: 0x21, flags: 0x0},
-	758:  {region: 0x12f, script: 0x57, flags: 0x0},
-	759:  {region: 0xc0, script: 0x57, flags: 0x0},
-	760:  {region: 0x165, script: 0x57, flags: 0x0},
-	761:  {region: 0x165, script: 0x57, flags: 0x0},
-	762:  {region: 0xe0, script: 0x57, flags: 0x0},
-	763:  {region: 0x165, script: 0x57, flags: 0x0},
-	764:  {region: 0x95, script: 0x57, flags: 0x0},
-	765:  {region: 0x9b, script: 0x3a, flags: 0x0},
-	766:  {region: 0x165, script: 0x57, flags: 0x0},
-	767:  {region: 0xc2, script: 0x1f, flags: 0x0},
-	768:  {region: 0x165, script: 0x5, flags: 0x0},
-	769:  {region: 0x165, script: 0x57, flags: 0x0},
-	770:  {region: 0x165, script: 0x57, flags: 0x0},
-	771:  {region: 0x165, script: 0x57, flags: 0x0},
-	772:  {region: 0x99, script: 0x6b, flags: 0x0},
-	773:  {region: 0x165, script: 0x57, flags: 0x0},
-	774:  {region: 0x165, script: 0x57, flags: 0x0},
-	775:  {region: 0x10b, script: 0x57, flags: 0x0},
-	776:  {region: 0x165, script: 0x57, flags: 0x0},
-	777:  {region: 0x165, script: 0x57, flags: 0x0},
-	778:  {region: 0x165, script: 0x57, flags: 0x0},
-	779:  {region: 0x26, script: 0x3, flags: 0x1},
-	780:  {region: 0x165, script: 0x57, flags: 0x0},
-	781:  {region: 0x165, script: 0x57, flags: 0x0},
-	782:  {region: 0x99, script: 0xe, flags: 0x0},
-	783:  {region: 0xc4, script: 0x72, flags: 0x0},
-	785:  {region: 0x165, script: 0x57, flags: 0x0},
-	786:  {region: 0x49, script: 0x57, flags: 0x0},
-	787:  {region: 0x49, script: 0x57, flags: 0x0},
-	788:  {region: 0x37, script: 0x57, flags: 0x0},
-	789:  {region: 0x165, script: 0x57, flags: 0x0},
-	790:  {region: 0x165, script: 0x57, flags: 0x0},
-	791:  {region: 0x165, script: 0x57, flags: 0x0},
-	792:  {region: 0x165, script: 0x57, flags: 0x0},
-	793:  {region: 0x165, script: 0x57, flags: 0x0},
-	794:  {region: 0x165, script: 0x57, flags: 0x0},
-	795:  {region: 0x99, script: 0x21, flags: 0x0},
-	796:  {region: 0xdb, script: 0x21, flags: 0x0},
-	797:  {region: 0x106, script: 0x1f, flags: 0x0},
-	798:  {region: 0x35, script: 0x6f, flags: 0x0},
-	799:  {region: 0x29, script: 0x3, flags: 0x1},
-	800:  {region: 0xcb, script: 0x57, flags: 0x0},
-	801:  {region: 0x165, script: 0x57, flags: 0x0},
-	802:  {region: 0x165, script: 0x57, flags: 0x0},
-	803:  {region: 0x165, script: 0x57, flags: 0x0},
-	804:  {region: 0x99, script: 0x21, flags: 0x0},
-	805:  {region: 0x52, script: 0x57, flags: 0x0},
-	807:  {region: 0x165, script: 0x57, flags: 0x0},
-	808:  {region: 0x135, script: 0x57, flags: 0x0},
-	809:  {region: 0x165, script: 0x57, flags: 0x0},
-	810:  {region: 0x165, script: 0x57, flags: 0x0},
-	811:  {region: 0xe8, script: 0x5, flags: 0x0},
-	812:  {region: 0xc3, script: 0x57, flags: 0x0},
-	813:  {region: 0x99, script: 0x21, flags: 0x0},
-	814:  {region: 0x95, script: 0x57, flags: 0x0},
-	815:  {region: 0x164, script: 0x57, flags: 0x0},
-	816:  {region: 0x165, script: 0x57, flags: 0x0},
-	817:  {region: 0xc4, script: 0x72, flags: 0x0},
-	818:  {region: 0x165, script: 0x57, flags: 0x0},
-	819:  {region: 0x165, script: 0x29, flags: 0x0},
-	820:  {region: 0x106, script: 0x1f, flags: 0x0},
-	821:  {region: 0x165, script: 0x57, flags: 0x0},
-	822:  {region: 0x131, script: 0x57, flags: 0x0},
-	823:  {region: 0x9c, script: 0x63, flags: 0x0},
-	824:  {region: 0x165, script: 0x57, flags: 0x0},
-	825:  {region: 0x165, script: 0x57, flags: 0x0},
-	826:  {region: 0x9c, script: 0x5, flags: 0x0},
-	827:  {region: 0x165, script: 0x57, flags: 0x0},
-	828:  {region: 0x165, script: 0x57, flags: 0x0},
-	829:  {region: 0x165, script: 0x57, flags: 0x0},
-	830:  {region: 0xdd, script: 0x57, flags: 0x0},
-	831:  {region: 0x165, script: 0x57, flags: 0x0},
-	832:  {region: 0x165, script: 0x57, flags: 0x0},
-	834:  {region: 0x165, script: 0x57, flags: 0x0},
-	835:  {region: 0x53, script: 0x38, flags: 0x0},
-	836:  {region: 0x9e, script: 0x57, flags: 0x0},
-	837:  {region: 0xd2, script: 0x57, flags: 0x0},
-	838:  {region: 0x165, script: 0x57, flags: 0x0},
-	839:  {region: 0xda, script: 0x57, flags: 0x0},
-	840:  {region: 0x165, script: 0x57, flags: 0x0},
-	841:  {region: 0x165, script: 0x57, flags: 0x0},
-	842:  {region: 0x165, script: 0x57, flags: 0x0},
-	843:  {region: 0xcf, script: 0x57, flags: 0x0},
-	844:  {region: 0x165, script: 0x57, flags: 0x0},
-	845:  {region: 0x165, script: 0x57, flags: 0x0},
-	846:  {region: 0x164, script: 0x57, flags: 0x0},
-	847:  {region: 0xd1, script: 0x57, flags: 0x0},
-	848:  {region: 0x60, script: 0x57, flags: 0x0},
-	849:  {region: 0xdb, script: 0x21, flags: 0x0},
-	850:  {region: 0x165, script: 0x57, flags: 0x0},
-	851:  {region: 0xdb, script: 0x21, flags: 0x0},
-	852:  {region: 0x165, script: 0x57, flags: 0x0},
-	853:  {region: 0x165, script: 0x57, flags: 0x0},
-	854:  {region: 0xd2, script: 0x57, flags: 0x0},
-	855:  {region: 0x165, script: 0x57, flags: 0x0},
-	856:  {region: 0x165, script: 0x57, flags: 0x0},
-	857:  {region: 0xd1, script: 0x57, flags: 0x0},
-	858:  {region: 0x165, script: 0x57, flags: 0x0},
-	859:  {region: 0xcf, script: 0x57, flags: 0x0},
-	860:  {region: 0xcf, script: 0x57, flags: 0x0},
-	861:  {region: 0x165, script: 0x57, flags: 0x0},
-	862:  {region: 0x165, script: 0x57, flags: 0x0},
-	863:  {region: 0x95, script: 0x57, flags: 0x0},
-	864:  {region: 0x165, script: 0x57, flags: 0x0},
-	865:  {region: 0xdf, script: 0x57, flags: 0x0},
-	866:  {region: 0x165, script: 0x57, flags: 0x0},
-	867:  {region: 0x165, script: 0x57, flags: 0x0},
-	868:  {region: 0x99, script: 0x57, flags: 0x0},
-	869:  {region: 0x165, script: 0x57, flags: 0x0},
-	870:  {region: 0x165, script: 0x57, flags: 0x0},
-	871:  {region: 0xd9, script: 0x57, flags: 0x0},
-	872:  {region: 0x52, script: 0x57, flags: 0x0},
-	873:  {region: 0x165, script: 0x57, flags: 0x0},
-	874:  {region: 0xda, script: 0x57, flags: 0x0},
-	875:  {region: 0x165, script: 0x57, flags: 0x0},
-	876:  {region: 0x52, script: 0x57, flags: 0x0},
-	877:  {region: 0x165, script: 0x57, flags: 0x0},
-	878:  {region: 0x165, script: 0x57, flags: 0x0},
-	879:  {region: 0xda, script: 0x57, flags: 0x0},
-	880:  {region: 0x123, script: 0x53, flags: 0x0},
-	881:  {region: 0x99, script: 0x21, flags: 0x0},
-	882:  {region: 0x10c, script: 0xbf, flags: 0x0},
-	883:  {region: 0x165, script: 0x57, flags: 0x0},
-	884:  {region: 0x165, script: 0x57, flags: 0x0},
-	885:  {region: 0x84, script: 0x78, flags: 0x0},
-	886:  {region: 0x161, script: 0x57, flags: 0x0},
-	887:  {region: 0x165, script: 0x57, flags: 0x0},
-	888:  {region: 0x49, script: 0x17, flags: 0x0},
-	889:  {region: 0x165, script: 0x57, flags: 0x0},
-	890:  {region: 0x161, script: 0x57, flags: 0x0},
-	891:  {region: 0x165, script: 0x57, flags: 0x0},
-	892:  {region: 0x165, script: 0x57, flags: 0x0},
-	893:  {region: 0x165, script: 0x57, flags: 0x0},
-	894:  {region: 0x165, script: 0x57, flags: 0x0},
-	895:  {region: 0x165, script: 0x57, flags: 0x0},
-	896:  {region: 0x117, script: 0x57, flags: 0x0},
-	897:  {region: 0x165, script: 0x57, flags: 0x0},
-	898:  {region: 0x165, script: 0x57, flags: 0x0},
-	899:  {region: 0x135, script: 0x57, flags: 0x0},
-	900:  {region: 0x165, script: 0x57, flags: 0x0},
-	901:  {region: 0x53, script: 0x57, flags: 0x0},
-	902:  {region: 0x165, script: 0x57, flags: 0x0},
-	903:  {region: 0xce, script: 0x57, flags: 0x0},
-	904:  {region: 0x12f, script: 0x57, flags: 0x0},
-	905:  {region: 0x131, script: 0x57, flags: 0x0},
-	906:  {region: 0x80, script: 0x57, flags: 0x0},
-	907:  {region: 0x78, script: 0x57, flags: 0x0},
-	908:  {region: 0x165, script: 0x57, flags: 0x0},
-	910:  {region: 0x165, script: 0x57, flags: 0x0},
-	911:  {region: 0x165, script: 0x57, flags: 0x0},
-	912:  {region: 0x6f, script: 0x57, flags: 0x0},
-	913:  {region: 0x165, script: 0x57, flags: 0x0},
-	914:  {region: 0x165, script: 0x57, flags: 0x0},
-	915:  {region: 0x165, script: 0x57, flags: 0x0},
-	916:  {region: 0x165, script: 0x57, flags: 0x0},
-	917:  {region: 0x99, script: 0x7d, flags: 0x0},
-	918:  {region: 0x165, script: 0x57, flags: 0x0},
-	919:  {region: 0x165, script: 0x5, flags: 0x0},
-	920:  {region: 0x7d, script: 0x1f, flags: 0x0},
-	921:  {region: 0x135, script: 0x7e, flags: 0x0},
-	922:  {region: 0x165, script: 0x5, flags: 0x0},
-	923:  {region: 0xc5, script: 0x7c, flags: 0x0},
-	924:  {region: 0x165, script: 0x57, flags: 0x0},
-	925:  {region: 0x2c, script: 0x3, flags: 0x1},
-	926:  {region: 0xe7, script: 0x57, flags: 0x0},
-	927:  {region: 0x2f, script: 0x2, flags: 0x1},
-	928:  {region: 0xe7, script: 0x57, flags: 0x0},
-	929:  {region: 0x30, script: 0x57, flags: 0x0},
-	930:  {region: 0xf0, script: 0x57, flags: 0x0},
-	931:  {region: 0x165, script: 0x57, flags: 0x0},
-	932:  {region: 0x78, script: 0x57, flags: 0x0},
-	933:  {region: 0xd6, script: 0x57, flags: 0x0},
-	934:  {region: 0x135, script: 0x57, flags: 0x0},
-	935:  {region: 0x49, script: 0x57, flags: 0x0},
-	936:  {region: 0x165, script: 0x57, flags: 0x0},
-	937:  {region: 0x9c, script: 0xe8, flags: 0x0},
-	938:  {region: 0x165, script: 0x57, flags: 0x0},
-	939:  {region: 0x60, script: 0x57, flags: 0x0},
-	940:  {region: 0x165, script: 0x5, flags: 0x0},
-	941:  {region: 0xb0, script: 0x87, flags: 0x0},
-	943:  {region: 0x165, script: 0x57, flags: 0x0},
-	944:  {region: 0x165, script: 0x57, flags: 0x0},
-	945:  {region: 0x99, script: 0x12, flags: 0x0},
-	946:  {region: 0xa4, script: 0x57, flags: 0x0},
-	947:  {region: 0xe9, script: 0x57, flags: 0x0},
-	948:  {region: 0x165, script: 0x57, flags: 0x0},
-	949:  {region: 0x9e, script: 0x57, flags: 0x0},
-	950:  {region: 0x165, script: 0x57, flags: 0x0},
-	951:  {region: 0x165, script: 0x57, flags: 0x0},
-	952:  {region: 0x87, script: 0x31, flags: 0x0},
-	953:  {region: 0x75, script: 0x57, flags: 0x0},
-	954:  {region: 0x165, script: 0x57, flags: 0x0},
-	955:  {region: 0xe8, script: 0x4a, flags: 0x0},
-	956:  {region: 0x9c, script: 0x5, flags: 0x0},
-	957:  {region: 0x1, script: 0x57, flags: 0x0},
-	958:  {region: 0x24, script: 0x5, flags: 0x0},
-	959:  {region: 0x165, script: 0x57, flags: 0x0},
-	960:  {region: 0x41, script: 0x57, flags: 0x0},
-	961:  {region: 0x165, script: 0x57, flags: 0x0},
-	962:  {region: 0x7a, script: 0x57, flags: 0x0},
-	963:  {region: 0x165, script: 0x57, flags: 0x0},
-	964:  {region: 0xe4, script: 0x57, flags: 0x0},
-	965:  {region: 0x89, script: 0x57, flags: 0x0},
-	966:  {region: 0x69, script: 0x57, flags: 0x0},
-	967:  {region: 0x165, script: 0x57, flags: 0x0},
-	968:  {region: 0x99, script: 0x21, flags: 0x0},
-	969:  {region: 0x165, script: 0x57, flags: 0x0},
-	970:  {region: 0x102, script: 0x57, flags: 0x0},
-	971:  {region: 0x95, script: 0x57, flags: 0x0},
-	972:  {region: 0x165, script: 0x57, flags: 0x0},
-	973:  {region: 0x165, script: 0x57, flags: 0x0},
-	974:  {region: 0x9e, script: 0x57, flags: 0x0},
-	975:  {region: 0x165, script: 0x5, flags: 0x0},
-	976:  {region: 0x99, script: 0x57, flags: 0x0},
-	977:  {region: 0x31, script: 0x2, flags: 0x1},
-	978:  {region: 0xdb, script: 0x21, flags: 0x0},
-	979:  {region: 0x35, script: 0xe, flags: 0x0},
-	980:  {region: 0x4e, script: 0x57, flags: 0x0},
-	981:  {region: 0x72, script: 0x57, flags: 0x0},
-	982:  {region: 0x4e, script: 0x57, flags: 0x0},
-	983:  {region: 0x9c, script: 0x5, flags: 0x0},
-	984:  {region: 0x10c, script: 0x57, flags: 0x0},
-	985:  {region: 0x3a, script: 0x57, flags: 0x0},
-	986:  {region: 0x165, script: 0x57, flags: 0x0},
-	987:  {region: 0xd1, script: 0x57, flags: 0x0},
-	988:  {region: 0x104, script: 0x57, flags: 0x0},
-	989:  {region: 0x95, script: 0x57, flags: 0x0},
-	990:  {region: 0x12f, script: 0x57, flags: 0x0},
-	991:  {region: 0x165, script: 0x57, flags: 0x0},
-	992:  {region: 0x165, script: 0x57, flags: 0x0},
-	993:  {region: 0x73, script: 0x57, flags: 0x0},
-	994:  {region: 0x106, script: 0x1f, flags: 0x0},
-	995:  {region: 0x130, script: 0x1f, flags: 0x0},
-	996:  {region: 0x109, script: 0x57, flags: 0x0},
-	997:  {region: 0x107, script: 0x57, flags: 0x0},
-	998:  {region: 0x12f, script: 0x57, flags: 0x0},
-	999:  {region: 0x165, script: 0x57, flags: 0x0},
-	1000: {region: 0xa2, script: 0x49, flags: 0x0},
-	1001: {region: 0x99, script: 0x21, flags: 0x0},
-	1002: {region: 0x80, script: 0x57, flags: 0x0},
-	1003: {region: 0x106, script: 0x1f, flags: 0x0},
-	1004: {region: 0xa4, script: 0x57, flags: 0x0},
-	1005: {region: 0x95, script: 0x57, flags: 0x0},
-	1006: {region: 0x99, script: 0x57, flags: 0x0},
-	1007: {region: 0x114, script: 0x57, flags: 0x0},
-	1008: {region: 0x99, script: 0xc3, flags: 0x0},
-	1009: {region: 0x165, script: 0x57, flags: 0x0},
-	1010: {region: 0x165, script: 0x57, flags: 0x0},
-	1011: {region: 0x12f, script: 0x57, flags: 0x0},
-	1012: {region: 0x9e, script: 0x57, flags: 0x0},
-	1013: {region: 0x99, script: 0x21, flags: 0x0},
-	1014: {region: 0x165, script: 0x5, flags: 0x0},
-	1015: {region: 0x9e, script: 0x57, flags: 0x0},
-	1016: {region: 0x7b, script: 0x57, flags: 0x0},
-	1017: {region: 0x49, script: 0x57, flags: 0x0},
-	1018: {region: 0x33, script: 0x4, flags: 0x1},
-	1019: {region: 0x9e, script: 0x57, flags: 0x0},
-	1020: {region: 0x9c, script: 0x5, flags: 0x0},
-	1021: {region: 0xda, script: 0x57, flags: 0x0},
-	1022: {region: 0x4f, script: 0x57, flags: 0x0},
-	1023: {region: 0xd1, script: 0x57, flags: 0x0},
-	1024: {region: 0xcf, script: 0x57, flags: 0x0},
-	1025: {region: 0xc3, script: 0x57, flags: 0x0},
-	1026: {region: 0x4c, script: 0x57, flags: 0x0},
-	1027: {region: 0x96, script: 0x7a, flags: 0x0},
-	1028: {region: 0xb6, script: 0x57, flags: 0x0},
-	1029: {region: 0x165, script: 0x29, flags: 0x0},
-	1030: {region: 0x165, script: 0x57, flags: 0x0},
-	1032: {region: 0xba, script: 0xdc, flags: 0x0},
-	1033: {region: 0x165, script: 0x57, flags: 0x0},
-	1034: {region: 0xc4, script: 0x72, flags: 0x0},
-	1035: {region: 0x165, script: 0x5, flags: 0x0},
-	1036: {region: 0xb3, script: 0xca, flags: 0x0},
-	1037: {region: 0x6f, script: 0x57, flags: 0x0},
-	1038: {region: 0x165, script: 0x57, flags: 0x0},
-	1039: {region: 0x165, script: 0x57, flags: 0x0},
-	1040: {region: 0x165, script: 0x57, flags: 0x0},
-	1041: {region: 0x165, script: 0x57, flags: 0x0},
-	1042: {region: 0x111, script: 0x57, flags: 0x0},
-	1043: {region: 0x165, script: 0x57, flags: 0x0},
-	1044: {region: 0xe8, script: 0x5, flags: 0x0},
-	1045: {region: 0x165, script: 0x57, flags: 0x0},
-	1046: {region: 0x10f, script: 0x57, flags: 0x0},
-	1047: {region: 0x165, script: 0x57, flags: 0x0},
-	1048: {region: 0xe9, script: 0x57, flags: 0x0},
-	1049: {region: 0x165, script: 0x57, flags: 0x0},
-	1050: {region: 0x95, script: 0x57, flags: 0x0},
-	1051: {region: 0x142, script: 0x57, flags: 0x0},
-	1052: {region: 0x10c, script: 0x57, flags: 0x0},
-	1054: {region: 0x10c, script: 0x57, flags: 0x0},
-	1055: {region: 0x72, script: 0x57, flags: 0x0},
-	1056: {region: 0x97, script: 0xc0, flags: 0x0},
-	1057: {region: 0x165, script: 0x57, flags: 0x0},
-	1058: {region: 0x72, script: 0x57, flags: 0x0},
-	1059: {region: 0x164, script: 0x57, flags: 0x0},
-	1060: {region: 0x165, script: 0x57, flags: 0x0},
-	1061: {region: 0xc3, script: 0x57, flags: 0x0},
-	1062: {region: 0x165, script: 0x57, flags: 0x0},
-	1063: {region: 0x165, script: 0x57, flags: 0x0},
-	1064: {region: 0x165, script: 0x57, flags: 0x0},
-	1065: {region: 0x115, script: 0x57, flags: 0x0},
-	1066: {region: 0x165, script: 0x57, flags: 0x0},
-	1067: {region: 0x165, script: 0x57, flags: 0x0},
-	1068: {region: 0x123, script: 0xdf, flags: 0x0},
-	1069: {region: 0x165, script: 0x57, flags: 0x0},
-	1070: {region: 0x165, script: 0x57, flags: 0x0},
-	1071: {region: 0x165, script: 0x57, flags: 0x0},
-	1072: {region: 0x165, script: 0x57, flags: 0x0},
-	1073: {region: 0x27, script: 0x57, flags: 0x0},
-	1074: {region: 0x37, script: 0x5, flags: 0x1},
-	1075: {region: 0x99, script: 0xcb, flags: 0x0},
-	1076: {region: 0x116, script: 0x57, flags: 0x0},
-	1077: {region: 0x114, script: 0x57, flags: 0x0},
-	1078: {region: 0x99, script: 0x21, flags: 0x0},
-	1079: {region: 0x161, script: 0x57, flags: 0x0},
-	1080: {region: 0x165, script: 0x57, flags: 0x0},
-	1081: {region: 0x165, script: 0x57, flags: 0x0},
-	1082: {region: 0x6d, script: 0x57, flags: 0x0},
-	1083: {region: 0x161, script: 0x57, flags: 0x0},
-	1084: {region: 0x165, script: 0x57, flags: 0x0},
-	1085: {region: 0x60, script: 0x57, flags: 0x0},
-	1086: {region: 0x95, script: 0x57, flags: 0x0},
-	1087: {region: 0x165, script: 0x57, flags: 0x0},
-	1088: {region: 0x165, script: 0x57, flags: 0x0},
-	1089: {region: 0x12f, script: 0x57, flags: 0x0},
-	1090: {region: 0x165, script: 0x57, flags: 0x0},
-	1091: {region: 0x84, script: 0x57, flags: 0x0},
-	1092: {region: 0x10c, script: 0x57, flags: 0x0},
-	1093: {region: 0x12f, script: 0x57, flags: 0x0},
-	1094: {region: 0x15f, script: 0x5, flags: 0x0},
-	1095: {region: 0x4b, script: 0x57, flags: 0x0},
-	1096: {region: 0x60, script: 0x57, flags: 0x0},
-	1097: {region: 0x165, script: 0x57, flags: 0x0},
-	1098: {region: 0x99, script: 0x21, flags: 0x0},
-	1099: {region: 0x95, script: 0x57, flags: 0x0},
-	1100: {region: 0x165, script: 0x57, flags: 0x0},
-	1101: {region: 0x35, script: 0xe, flags: 0x0},
-	1102: {region: 0x9b, script: 0xcf, flags: 0x0},
-	1103: {region: 0xe9, script: 0x57, flags: 0x0},
-	1104: {region: 0x99, script: 0xd7, flags: 0x0},
-	1105: {region: 0xdb, script: 0x21, flags: 0x0},
-	1106: {region: 0x165, script: 0x57, flags: 0x0},
-	1107: {region: 0x165, script: 0x57, flags: 0x0},
-	1108: {region: 0x165, script: 0x57, flags: 0x0},
-	1109: {region: 0x165, script: 0x57, flags: 0x0},
-	1110: {region: 0x165, script: 0x57, flags: 0x0},
-	1111: {region: 0x165, script: 0x57, flags: 0x0},
-	1112: {region: 0x165, script: 0x57, flags: 0x0},
-	1113: {region: 0x165, script: 0x57, flags: 0x0},
-	1114: {region: 0xe7, script: 0x57, flags: 0x0},
-	1115: {region: 0x165, script: 0x57, flags: 0x0},
-	1116: {region: 0x165, script: 0x57, flags: 0x0},
-	1117: {region: 0x99, script: 0x4f, flags: 0x0},
-	1118: {region: 0x53, script: 0xd5, flags: 0x0},
-	1119: {region: 0xdb, script: 0x21, flags: 0x0},
-	1120: {region: 0xdb, script: 0x21, flags: 0x0},
-	1121: {region: 0x99, script: 0xda, flags: 0x0},
-	1122: {region: 0x165, script: 0x57, flags: 0x0},
-	1123: {region: 0x112, script: 0x57, flags: 0x0},
-	1124: {region: 0x131, script: 0x57, flags: 0x0},
-	1125: {region: 0x126, script: 0x57, flags: 0x0},
-	1126: {region: 0x165, script: 0x57, flags: 0x0},
-	1127: {region: 0x3c, script: 0x3, flags: 0x1},
-	1128: {region: 0x165, script: 0x57, flags: 0x0},
-	1129: {region: 0x165, script: 0x57, flags: 0x0},
-	1130: {region: 0x165, script: 0x57, flags: 0x0},
-	1131: {region: 0x123, script: 0xdf, flags: 0x0},
-	1132: {region: 0xdb, script: 0x21, flags: 0x0},
-	1133: {region: 0xdb, script: 0x21, flags: 0x0},
-	1134: {region: 0xdb, script: 0x21, flags: 0x0},
-	1135: {region: 0x6f, script: 0x29, flags: 0x0},
-	1136: {region: 0x165, script: 0x57, flags: 0x0},
-	1137: {region: 0x6d, script: 0x29, flags: 0x0},
-	1138: {region: 0x165, script: 0x57, flags: 0x0},
-	1139: {region: 0x165, script: 0x57, flags: 0x0},
-	1140: {region: 0x165, script: 0x57, flags: 0x0},
-	1141: {region: 0xd6, script: 0x57, flags: 0x0},
-	1142: {region: 0x127, script: 0x57, flags: 0x0},
-	1143: {region: 0x125, script: 0x57, flags: 0x0},
-	1144: {region: 0x32, script: 0x57, flags: 0x0},
-	1145: {region: 0xdb, script: 0x21, flags: 0x0},
-	1146: {region: 0xe7, script: 0x57, flags: 0x0},
-	1147: {region: 0x165, script: 0x57, flags: 0x0},
-	1148: {region: 0x165, script: 0x57, flags: 0x0},
-	1149: {region: 0x32, script: 0x57, flags: 0x0},
-	1150: {region: 0xd4, script: 0x57, flags: 0x0},
-	1151: {region: 0x165, script: 0x57, flags: 0x0},
-	1152: {region: 0x161, script: 0x57, flags: 0x0},
-	1153: {region: 0x165, script: 0x57, flags: 0x0},
-	1154: {region: 0x129, script: 0x57, flags: 0x0},
-	1155: {region: 0x165, script: 0x57, flags: 0x0},
-	1156: {region: 0xce, script: 0x57, flags: 0x0},
-	1157: {region: 0x165, script: 0x57, flags: 0x0},
-	1158: {region: 0xe6, script: 0x57, flags: 0x0},
-	1159: {region: 0x165, script: 0x57, flags: 0x0},
-	1160: {region: 0x165, script: 0x57, flags: 0x0},
-	1161: {region: 0x165, script: 0x57, flags: 0x0},
-	1162: {region: 0x12b, script: 0x57, flags: 0x0},
-	1163: {region: 0x12b, script: 0x57, flags: 0x0},
-	1164: {region: 0x12e, script: 0x57, flags: 0x0},
-	1165: {region: 0x165, script: 0x5, flags: 0x0},
-	1166: {region: 0x161, script: 0x57, flags: 0x0},
-	1167: {region: 0x87, script: 0x31, flags: 0x0},
-	1168: {region: 0xdb, script: 0x21, flags: 0x0},
-	1169: {region: 0xe7, script: 0x57, flags: 0x0},
-	1170: {region: 0x43, script: 0xe0, flags: 0x0},
-	1171: {region: 0x165, script: 0x57, flags: 0x0},
-	1172: {region: 0x106, script: 0x1f, flags: 0x0},
-	1173: {region: 0x165, script: 0x57, flags: 0x0},
-	1174: {region: 0x165, script: 0x57, flags: 0x0},
-	1175: {region: 0x131, script: 0x57, flags: 0x0},
-	1176: {region: 0x165, script: 0x57, flags: 0x0},
-	1177: {region: 0x123, script: 0xdf, flags: 0x0},
-	1178: {region: 0x32, script: 0x57, flags: 0x0},
-	1179: {region: 0x165, script: 0x57, flags: 0x0},
-	1180: {region: 0x165, script: 0x57, flags: 0x0},
-	1181: {region: 0xce, script: 0x57, flags: 0x0},
-	1182: {region: 0x165, script: 0x57, flags: 0x0},
-	1183: {region: 0x165, script: 0x57, flags: 0x0},
-	1184: {region: 0x12d, script: 0x57, flags: 0x0},
-	1185: {region: 0x165, script: 0x57, flags: 0x0},
-	1187: {region: 0x165, script: 0x57, flags: 0x0},
-	1188: {region: 0xd4, script: 0x57, flags: 0x0},
-	1189: {region: 0x53, script: 0xd8, flags: 0x0},
-	1190: {region: 0xe5, script: 0x57, flags: 0x0},
-	1191: {region: 0x165, script: 0x57, flags: 0x0},
-	1192: {region: 0x106, script: 0x1f, flags: 0x0},
-	1193: {region: 0xba, script: 0x57, flags: 0x0},
-	1194: {region: 0x165, script: 0x57, flags: 0x0},
-	1195: {region: 0x106, script: 0x1f, flags: 0x0},
-	1196: {region: 0x3f, script: 0x4, flags: 0x1},
-	1197: {region: 0x11c, script: 0xe2, flags: 0x0},
-	1198: {region: 0x130, script: 0x1f, flags: 0x0},
-	1199: {region: 0x75, script: 0x57, flags: 0x0},
-	1200: {region: 0x2a, script: 0x57, flags: 0x0},
-	1202: {region: 0x43, script: 0x3, flags: 0x1},
-	1203: {region: 0x99, script: 0xe, flags: 0x0},
-	1204: {region: 0xe8, script: 0x5, flags: 0x0},
-	1205: {region: 0x165, script: 0x57, flags: 0x0},
-	1206: {region: 0x165, script: 0x57, flags: 0x0},
-	1207: {region: 0x165, script: 0x57, flags: 0x0},
-	1208: {region: 0x165, script: 0x57, flags: 0x0},
-	1209: {region: 0x165, script: 0x57, flags: 0x0},
-	1210: {region: 0x165, script: 0x57, flags: 0x0},
-	1211: {region: 0x165, script: 0x57, flags: 0x0},
-	1212: {region: 0x46, script: 0x4, flags: 0x1},
-	1213: {region: 0x165, script: 0x57, flags: 0x0},
-	1214: {region: 0xb4, script: 0xe3, flags: 0x0},
-	1215: {region: 0x165, script: 0x57, flags: 0x0},
-	1216: {region: 0x161, script: 0x57, flags: 0x0},
-	1217: {region: 0x9e, script: 0x57, flags: 0x0},
-	1218: {region: 0x106, script: 0x57, flags: 0x0},
-	1219: {region: 0x13e, script: 0x57, flags: 0x0},
-	1220: {region: 0x11b, script: 0x57, flags: 0x0},
-	1221: {region: 0x165, script: 0x57, flags: 0x0},
-	1222: {region: 0x36, script: 0x57, flags: 0x0},
-	1223: {region: 0x60, script: 0x57, flags: 0x0},
-	1224: {region: 0xd1, script: 0x57, flags: 0x0},
-	1225: {region: 0x1, script: 0x57, flags: 0x0},
-	1226: {region: 0x106, script: 0x57, flags: 0x0},
-	1227: {region: 0x6a, script: 0x57, flags: 0x0},
-	1228: {region: 0x12f, script: 0x57, flags: 0x0},
-	1229: {region: 0x165, script: 0x57, flags: 0x0},
-	1230: {region: 0x36, script: 0x57, flags: 0x0},
-	1231: {region: 0x4e, script: 0x57, flags: 0x0},
-	1232: {region: 0x165, script: 0x57, flags: 0x0},
-	1233: {region: 0x6f, script: 0x29, flags: 0x0},
-	1234: {region: 0x165, script: 0x57, flags: 0x0},
-	1235: {region: 0xe7, script: 0x57, flags: 0x0},
-	1236: {region: 0x2f, script: 0x57, flags: 0x0},
-	1237: {region: 0x99, script: 0xda, flags: 0x0},
-	1238: {region: 0x99, script: 0x21, flags: 0x0},
-	1239: {region: 0x165, script: 0x57, flags: 0x0},
-	1240: {region: 0x165, script: 0x57, flags: 0x0},
-	1241: {region: 0x165, script: 0x57, flags: 0x0},
-	1242: {region: 0x165, script: 0x57, flags: 0x0},
-	1243: {region: 0x165, script: 0x57, flags: 0x0},
-	1244: {region: 0x165, script: 0x57, flags: 0x0},
-	1245: {region: 0x165, script: 0x57, flags: 0x0},
-	1246: {region: 0x165, script: 0x57, flags: 0x0},
-	1247: {region: 0x165, script: 0x57, flags: 0x0},
-	1248: {region: 0x140, script: 0x57, flags: 0x0},
-	1249: {region: 0x165, script: 0x57, flags: 0x0},
-	1250: {region: 0x165, script: 0x57, flags: 0x0},
-	1251: {region: 0xa8, script: 0x5, flags: 0x0},
-	1252: {region: 0x165, script: 0x57, flags: 0x0},
-	1253: {region: 0x114, script: 0x57, flags: 0x0},
-	1254: {region: 0x165, script: 0x57, flags: 0x0},
-	1255: {region: 0x165, script: 0x57, flags: 0x0},
-	1256: {region: 0x165, script: 0x57, flags: 0x0},
-	1257: {region: 0x165, script: 0x57, flags: 0x0},
-	1258: {region: 0x99, script: 0x21, flags: 0x0},
-	1259: {region: 0x53, script: 0x38, flags: 0x0},
-	1260: {region: 0x165, script: 0x57, flags: 0x0},
-	1261: {region: 0x165, script: 0x57, flags: 0x0},
-	1262: {region: 0x41, script: 0x57, flags: 0x0},
-	1263: {region: 0x165, script: 0x57, flags: 0x0},
-	1264: {region: 0x12b, script: 0x18, flags: 0x0},
-	1265: {region: 0x165, script: 0x57, flags: 0x0},
-	1266: {region: 0x161, script: 0x57, flags: 0x0},
-	1267: {region: 0x165, script: 0x57, flags: 0x0},
-	1268: {region: 0x12b, script: 0x5f, flags: 0x0},
-	1269: {region: 0x12b, script: 0x60, flags: 0x0},
-	1270: {region: 0x7d, script: 0x2b, flags: 0x0},
-	1271: {region: 0x53, script: 0x64, flags: 0x0},
-	1272: {region: 0x10b, script: 0x69, flags: 0x0},
-	1273: {region: 0x108, script: 0x73, flags: 0x0},
-	1274: {region: 0x99, script: 0x21, flags: 0x0},
-	1275: {region: 0x131, script: 0x57, flags: 0x0},
-	1276: {region: 0x165, script: 0x57, flags: 0x0},
-	1277: {region: 0x9c, script: 0x8a, flags: 0x0},
-	1278: {region: 0x165, script: 0x57, flags: 0x0},
-	1279: {region: 0x15e, script: 0xc2, flags: 0x0},
-	1280: {region: 0x165, script: 0x57, flags: 0x0},
-	1281: {region: 0x165, script: 0x57, flags: 0x0},
-	1282: {region: 0xdb, script: 0x21, flags: 0x0},
-	1283: {region: 0x165, script: 0x57, flags: 0x0},
-	1284: {region: 0x165, script: 0x57, flags: 0x0},
-	1285: {region: 0xd1, script: 0x57, flags: 0x0},
-	1286: {region: 0x75, script: 0x57, flags: 0x0},
-	1287: {region: 0x165, script: 0x57, flags: 0x0},
-	1288: {region: 0x165, script: 0x57, flags: 0x0},
-	1289: {region: 0x52, script: 0x57, flags: 0x0},
-	1290: {region: 0x165, script: 0x57, flags: 0x0},
-	1291: {region: 0x165, script: 0x57, flags: 0x0},
-	1292: {region: 0x165, script: 0x57, flags: 0x0},
-	1293: {region: 0x52, script: 0x57, flags: 0x0},
-	1294: {region: 0x165, script: 0x57, flags: 0x0},
-	1295: {region: 0x165, script: 0x57, flags: 0x0},
-	1296: {region: 0x165, script: 0x57, flags: 0x0},
-	1297: {region: 0x165, script: 0x57, flags: 0x0},
-	1298: {region: 0x1, script: 0x3b, flags: 0x0},
-	1299: {region: 0x165, script: 0x57, flags: 0x0},
-	1300: {region: 0x165, script: 0x57, flags: 0x0},
-	1301: {region: 0x165, script: 0x57, flags: 0x0},
-	1302: {region: 0x165, script: 0x57, flags: 0x0},
-	1303: {region: 0x165, script: 0x57, flags: 0x0},
-	1304: {region: 0xd6, script: 0x57, flags: 0x0},
-	1305: {region: 0x165, script: 0x57, flags: 0x0},
-	1306: {region: 0x165, script: 0x57, flags: 0x0},
-	1307: {region: 0x165, script: 0x57, flags: 0x0},
-	1308: {region: 0x41, script: 0x57, flags: 0x0},
-	1309: {region: 0x165, script: 0x57, flags: 0x0},
-	1310: {region: 0xcf, script: 0x57, flags: 0x0},
-	1311: {region: 0x4a, script: 0x3, flags: 0x1},
-	1312: {region: 0x165, script: 0x57, flags: 0x0},
-	1313: {region: 0x165, script: 0x57, flags: 0x0},
-	1314: {region: 0x165, script: 0x57, flags: 0x0},
-	1315: {region: 0x53, script: 0x57, flags: 0x0},
-	1316: {region: 0x10b, script: 0x57, flags: 0x0},
-	1318: {region: 0xa8, script: 0x5, flags: 0x0},
-	1319: {region: 0xd9, script: 0x57, flags: 0x0},
-	1320: {region: 0xba, script: 0xdc, flags: 0x0},
-	1321: {region: 0x4d, script: 0x14, flags: 0x1},
-	1322: {region: 0x53, script: 0x79, flags: 0x0},
-	1323: {region: 0x165, script: 0x57, flags: 0x0},
-	1324: {region: 0x122, script: 0x57, flags: 0x0},
-	1325: {region: 0xd0, script: 0x57, flags: 0x0},
-	1326: {region: 0x165, script: 0x57, flags: 0x0},
-	1327: {region: 0x161, script: 0x57, flags: 0x0},
-	1329: {region: 0x12b, script: 0x57, flags: 0x0},
-}
-
-// likelyLangList holds lists info associated with likelyLang.
-// Size: 388 bytes, 97 elements
-var likelyLangList = [97]likelyScriptRegion{
-	0:  {region: 0x9c, script: 0x7, flags: 0x0},
-	1:  {region: 0xa1, script: 0x74, flags: 0x2},
-	2:  {region: 0x11c, script: 0x80, flags: 0x2},
-	3:  {region: 0x32, script: 0x57, flags: 0x0},
-	4:  {region: 0x9b, script: 0x5, flags: 0x4},
-	5:  {region: 0x9c, script: 0x5, flags: 0x4},
-	6:  {region: 0x106, script: 0x1f, flags: 0x4},
-	7:  {region: 0x9c, script: 0x5, flags: 0x2},
-	8:  {region: 0x106, script: 0x1f, flags: 0x0},
-	9:  {region: 0x38, script: 0x2c, flags: 0x2},
-	10: {region: 0x135, script: 0x57, flags: 0x0},
-	11: {region: 0x7b, script: 0xc5, flags: 0x2},
-	12: {region: 0x114, script: 0x57, flags: 0x0},
-	13: {region: 0x84, script: 0x1, flags: 0x2},
-	14: {region: 0x5d, script: 0x1e, flags: 0x0},
-	15: {region: 0x87, script: 0x5c, flags: 0x2},
-	16: {region: 0xd6, script: 0x57, flags: 0x0},
-	17: {region: 0x52, script: 0x5, flags: 0x4},
-	18: {region: 0x10b, script: 0x5, flags: 0x4},
-	19: {region: 0xae, script: 0x1f, flags: 0x0},
-	20: {region: 0x24, script: 0x5, flags: 0x4},
-	21: {region: 0x53, script: 0x5, flags: 0x4},
-	22: {region: 0x9c, script: 0x5, flags: 0x4},
-	23: {region: 0xc5, script: 0x5, flags: 0x4},
-	24: {region: 0x53, script: 0x5, flags: 0x2},
-	25: {region: 0x12b, script: 0x57, flags: 0x0},
-	26: {region: 0xb0, script: 0x5, flags: 0x4},
-	27: {region: 0x9b, script: 0x5, flags: 0x2},
-	28: {region: 0xa5, script: 0x1f, flags: 0x0},
-	29: {region: 0x53, script: 0x5, flags: 0x4},
-	30: {region: 0x12b, script: 0x57, flags: 0x4},
-	31: {region: 0x53, script: 0x5, flags: 0x2},
-	32: {region: 0x12b, script: 0x57, flags: 0x2},
-	33: {region: 0xdb, script: 0x21, flags: 0x0},
-	34: {region: 0x99, script: 0x5a, flags: 0x2},
-	35: {region: 0x83, script: 0x57, flags: 0x0},
-	36: {region: 0x84, script: 0x78, flags: 0x4},
-	37: {region: 0x84, script: 0x78, flags: 0x2},
-	38: {region: 0xc5, script: 0x1f, flags: 0x0},
-	39: {region: 0x53, script: 0x6d, flags: 0x4},
-	40: {region: 0x53, script: 0x6d, flags: 0x2},
-	41: {region: 0xd0, script: 0x57, flags: 0x0},
-	42: {region: 0x4a, script: 0x5, flags: 0x4},
-	43: {region: 0x95, script: 0x5, flags: 0x4},
-	44: {region: 0x99, script: 0x33, flags: 0x0},
-	45: {region: 0xe8, script: 0x5, flags: 0x4},
-	46: {region: 0xe8, script: 0x5, flags: 0x2},
-	47: {region: 0x9c, script: 0x84, flags: 0x0},
-	48: {region: 0x53, script: 0x85, flags: 0x2},
-	49: {region: 0xba, script: 0xdc, flags: 0x0},
-	50: {region: 0xd9, script: 0x57, flags: 0x4},
-	51: {region: 0xe8, script: 0x5, flags: 0x0},
-	52: {region: 0x99, script: 0x21, flags: 0x2},
-	53: {region: 0x99, script: 0x4c, flags: 0x2},
-	54: {region: 0x99, script: 0xc9, flags: 0x2},
-	55: {region: 0x105, script: 0x1f, flags: 0x0},
-	56: {region: 0xbd, script: 0x57, flags: 0x4},
-	57: {region: 0x104, script: 0x57, flags: 0x4},
-	58: {region: 0x106, script: 0x57, flags: 0x4},
-	59: {region: 0x12b, script: 0x57, flags: 0x4},
-	60: {region: 0x124, script: 0x1f, flags: 0x0},
-	61: {region: 0xe8, script: 0x5, flags: 0x4},
-	62: {region: 0xe8, script: 0x5, flags: 0x2},
-	63: {region: 0x53, script: 0x5, flags: 0x0},
-	64: {region: 0xae, script: 0x1f, flags: 0x4},
-	65: {region: 0xc5, script: 0x1f, flags: 0x4},
-	66: {region: 0xae, script: 0x1f, flags: 0x2},
-	67: {region: 0x99, script: 0xe, flags: 0x0},
-	68: {region: 0xdb, script: 0x21, flags: 0x4},
-	69: {region: 0xdb, script: 0x21, flags: 0x2},
-	70: {region: 0x137, script: 0x57, flags: 0x0},
-	71: {region: 0x24, script: 0x5, flags: 0x4},
-	72: {region: 0x53, script: 0x1f, flags: 0x4},
-	73: {region: 0x24, script: 0x5, flags: 0x2},
-	74: {region: 0x8d, script: 0x39, flags: 0x0},
-	75: {region: 0x53, script: 0x38, flags: 0x4},
-	76: {region: 0x53, script: 0x38, flags: 0x2},
-	77: {region: 0x53, script: 0x38, flags: 0x0},
-	78: {region: 0x2f, script: 0x39, flags: 0x4},
-	79: {region: 0x3e, script: 0x39, flags: 0x4},
-	80: {region: 0x7b, script: 0x39, flags: 0x4},
-	81: {region: 0x7e, script: 0x39, flags: 0x4},
-	82: {region: 0x8d, script: 0x39, flags: 0x4},
-	83: {region: 0x95, script: 0x39, flags: 0x4},
-	84: {region: 0xc6, script: 0x39, flags: 0x4},
-	85: {region: 0xd0, script: 0x39, flags: 0x4},
-	86: {region: 0xe2, script: 0x39, flags: 0x4},
-	87: {region: 0xe5, script: 0x39, flags: 0x4},
-	88: {region: 0xe7, script: 0x39, flags: 0x4},
-	89: {region: 0x116, script: 0x39, flags: 0x4},
-	90: {region: 0x123, script: 0x39, flags: 0x4},
-	91: {region: 0x12e, script: 0x39, flags: 0x4},
-	92: {region: 0x135, script: 0x39, flags: 0x4},
-	93: {region: 0x13e, script: 0x39, flags: 0x4},
-	94: {region: 0x12e, script: 0x11, flags: 0x2},
-	95: {region: 0x12e, script: 0x34, flags: 0x2},
-	96: {region: 0x12e, script: 0x39, flags: 0x2},
-}
-
-type likelyLangScript struct {
-	lang   uint16
-	script uint8
-	flags  uint8
-}
-
-// likelyRegion is a lookup table, indexed by regionID, for the most likely
-// languages and scripts given incomplete information. If more entries exist
-// for a given regionID, lang and script are the index and size respectively
-// of the list in likelyRegionList.
-// TODO: exclude containers and user-definable regions from the list.
-// Size: 1432 bytes, 358 elements
-var likelyRegion = [358]likelyLangScript{
-	34:  {lang: 0xd7, script: 0x57, flags: 0x0},
-	35:  {lang: 0x3a, script: 0x5, flags: 0x0},
-	36:  {lang: 0x0, script: 0x2, flags: 0x1},
-	39:  {lang: 0x2, script: 0x2, flags: 0x1},
-	40:  {lang: 0x4, script: 0x2, flags: 0x1},
-	42:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	43:  {lang: 0x0, script: 0x57, flags: 0x0},
-	44:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	45:  {lang: 0x41b, script: 0x57, flags: 0x0},
-	46:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	48:  {lang: 0x367, script: 0x57, flags: 0x0},
-	49:  {lang: 0x444, script: 0x57, flags: 0x0},
-	50:  {lang: 0x58, script: 0x57, flags: 0x0},
-	51:  {lang: 0x6, script: 0x2, flags: 0x1},
-	53:  {lang: 0xa5, script: 0xe, flags: 0x0},
-	54:  {lang: 0x367, script: 0x57, flags: 0x0},
-	55:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	56:  {lang: 0x7e, script: 0x1f, flags: 0x0},
-	57:  {lang: 0x3a, script: 0x5, flags: 0x0},
-	58:  {lang: 0x3d9, script: 0x57, flags: 0x0},
-	59:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	60:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	62:  {lang: 0x31f, script: 0x57, flags: 0x0},
-	63:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	64:  {lang: 0x3a1, script: 0x57, flags: 0x0},
-	65:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	67:  {lang: 0x8, script: 0x2, flags: 0x1},
-	69:  {lang: 0x0, script: 0x57, flags: 0x0},
-	71:  {lang: 0x71, script: 0x1f, flags: 0x0},
-	73:  {lang: 0x512, script: 0x3b, flags: 0x2},
-	74:  {lang: 0x31f, script: 0x5, flags: 0x2},
-	75:  {lang: 0x445, script: 0x57, flags: 0x0},
-	76:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	77:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	78:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	79:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	81:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	82:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	83:  {lang: 0xa, script: 0x4, flags: 0x1},
-	84:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	85:  {lang: 0x0, script: 0x57, flags: 0x0},
-	86:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	89:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	90:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	91:  {lang: 0x3a1, script: 0x57, flags: 0x0},
-	93:  {lang: 0xe, script: 0x2, flags: 0x1},
-	94:  {lang: 0xfa, script: 0x57, flags: 0x0},
-	96:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	98:  {lang: 0x1, script: 0x57, flags: 0x0},
-	99:  {lang: 0x101, script: 0x57, flags: 0x0},
-	101: {lang: 0x13e, script: 0x57, flags: 0x0},
-	103: {lang: 0x10, script: 0x2, flags: 0x1},
-	104: {lang: 0x13e, script: 0x57, flags: 0x0},
-	105: {lang: 0x13e, script: 0x57, flags: 0x0},
-	106: {lang: 0x140, script: 0x57, flags: 0x0},
-	107: {lang: 0x3a, script: 0x5, flags: 0x0},
-	108: {lang: 0x3a, script: 0x5, flags: 0x0},
-	109: {lang: 0x46f, script: 0x29, flags: 0x0},
-	110: {lang: 0x13e, script: 0x57, flags: 0x0},
-	111: {lang: 0x12, script: 0x2, flags: 0x1},
-	113: {lang: 0x10d, script: 0x57, flags: 0x0},
-	114: {lang: 0x151, script: 0x57, flags: 0x0},
-	115: {lang: 0x1c0, script: 0x21, flags: 0x2},
-	118: {lang: 0x158, script: 0x57, flags: 0x0},
-	120: {lang: 0x15e, script: 0x57, flags: 0x0},
-	122: {lang: 0x15e, script: 0x57, flags: 0x0},
-	123: {lang: 0x14, script: 0x2, flags: 0x1},
-	125: {lang: 0x16, script: 0x3, flags: 0x1},
-	126: {lang: 0x15e, script: 0x57, flags: 0x0},
-	128: {lang: 0x21, script: 0x57, flags: 0x0},
-	130: {lang: 0x245, script: 0x57, flags: 0x0},
-	132: {lang: 0x15e, script: 0x57, flags: 0x0},
-	133: {lang: 0x15e, script: 0x57, flags: 0x0},
-	134: {lang: 0x13e, script: 0x57, flags: 0x0},
-	135: {lang: 0x19, script: 0x2, flags: 0x1},
-	136: {lang: 0x0, script: 0x57, flags: 0x0},
-	137: {lang: 0x13e, script: 0x57, flags: 0x0},
-	139: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	141: {lang: 0x529, script: 0x39, flags: 0x0},
-	142: {lang: 0x0, script: 0x57, flags: 0x0},
-	143: {lang: 0x13e, script: 0x57, flags: 0x0},
-	144: {lang: 0x1d1, script: 0x57, flags: 0x0},
-	145: {lang: 0x1d4, script: 0x57, flags: 0x0},
-	146: {lang: 0x1d5, script: 0x57, flags: 0x0},
-	148: {lang: 0x13e, script: 0x57, flags: 0x0},
-	149: {lang: 0x1b, script: 0x2, flags: 0x1},
-	151: {lang: 0x1bc, script: 0x3b, flags: 0x0},
-	153: {lang: 0x1d, script: 0x3, flags: 0x1},
-	155: {lang: 0x3a, script: 0x5, flags: 0x0},
-	156: {lang: 0x20, script: 0x2, flags: 0x1},
-	157: {lang: 0x1f8, script: 0x57, flags: 0x0},
-	158: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	161: {lang: 0x3a, script: 0x5, flags: 0x0},
-	162: {lang: 0x200, script: 0x46, flags: 0x0},
-	164: {lang: 0x445, script: 0x57, flags: 0x0},
-	165: {lang: 0x28a, script: 0x1f, flags: 0x0},
-	166: {lang: 0x22, script: 0x3, flags: 0x1},
-	168: {lang: 0x25, script: 0x2, flags: 0x1},
-	170: {lang: 0x254, script: 0x50, flags: 0x0},
-	171: {lang: 0x254, script: 0x50, flags: 0x0},
-	172: {lang: 0x3a, script: 0x5, flags: 0x0},
-	174: {lang: 0x3e2, script: 0x1f, flags: 0x0},
-	175: {lang: 0x27, script: 0x2, flags: 0x1},
-	176: {lang: 0x3a, script: 0x5, flags: 0x0},
-	178: {lang: 0x10d, script: 0x57, flags: 0x0},
-	179: {lang: 0x40c, script: 0xca, flags: 0x0},
-	181: {lang: 0x43b, script: 0x57, flags: 0x0},
-	182: {lang: 0x2c0, script: 0x57, flags: 0x0},
-	183: {lang: 0x15e, script: 0x57, flags: 0x0},
-	184: {lang: 0x2c7, script: 0x57, flags: 0x0},
-	185: {lang: 0x3a, script: 0x5, flags: 0x0},
-	186: {lang: 0x29, script: 0x2, flags: 0x1},
-	187: {lang: 0x15e, script: 0x57, flags: 0x0},
-	188: {lang: 0x2b, script: 0x2, flags: 0x1},
-	189: {lang: 0x432, script: 0x57, flags: 0x0},
-	190: {lang: 0x15e, script: 0x57, flags: 0x0},
-	191: {lang: 0x2f1, script: 0x57, flags: 0x0},
-	194: {lang: 0x2d, script: 0x2, flags: 0x1},
-	195: {lang: 0xa0, script: 0x57, flags: 0x0},
-	196: {lang: 0x2f, script: 0x2, flags: 0x1},
-	197: {lang: 0x31, script: 0x2, flags: 0x1},
-	198: {lang: 0x33, script: 0x2, flags: 0x1},
-	200: {lang: 0x15e, script: 0x57, flags: 0x0},
-	201: {lang: 0x35, script: 0x2, flags: 0x1},
-	203: {lang: 0x320, script: 0x57, flags: 0x0},
-	204: {lang: 0x37, script: 0x3, flags: 0x1},
-	205: {lang: 0x128, script: 0xde, flags: 0x0},
-	207: {lang: 0x13e, script: 0x57, flags: 0x0},
-	208: {lang: 0x31f, script: 0x57, flags: 0x0},
-	209: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	210: {lang: 0x16, script: 0x57, flags: 0x0},
-	211: {lang: 0x15e, script: 0x57, flags: 0x0},
-	212: {lang: 0x1b4, script: 0x57, flags: 0x0},
-	214: {lang: 0x1b4, script: 0x5, flags: 0x2},
-	216: {lang: 0x13e, script: 0x57, flags: 0x0},
-	217: {lang: 0x367, script: 0x57, flags: 0x0},
-	218: {lang: 0x347, script: 0x57, flags: 0x0},
-	219: {lang: 0x351, script: 0x21, flags: 0x0},
-	225: {lang: 0x3a, script: 0x5, flags: 0x0},
-	226: {lang: 0x13e, script: 0x57, flags: 0x0},
-	228: {lang: 0x13e, script: 0x57, flags: 0x0},
-	229: {lang: 0x15e, script: 0x57, flags: 0x0},
-	230: {lang: 0x486, script: 0x57, flags: 0x0},
-	231: {lang: 0x153, script: 0x57, flags: 0x0},
-	232: {lang: 0x3a, script: 0x3, flags: 0x1},
-	233: {lang: 0x3b3, script: 0x57, flags: 0x0},
-	234: {lang: 0x15e, script: 0x57, flags: 0x0},
-	236: {lang: 0x13e, script: 0x57, flags: 0x0},
-	237: {lang: 0x3a, script: 0x5, flags: 0x0},
-	238: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	240: {lang: 0x3a2, script: 0x57, flags: 0x0},
-	241: {lang: 0x194, script: 0x57, flags: 0x0},
-	243: {lang: 0x3a, script: 0x5, flags: 0x0},
-	258: {lang: 0x15e, script: 0x57, flags: 0x0},
-	260: {lang: 0x3d, script: 0x2, flags: 0x1},
-	261: {lang: 0x432, script: 0x1f, flags: 0x0},
-	262: {lang: 0x3f, script: 0x2, flags: 0x1},
-	263: {lang: 0x3e5, script: 0x57, flags: 0x0},
-	264: {lang: 0x3a, script: 0x5, flags: 0x0},
-	266: {lang: 0x15e, script: 0x57, flags: 0x0},
-	267: {lang: 0x3a, script: 0x5, flags: 0x0},
-	268: {lang: 0x41, script: 0x2, flags: 0x1},
-	271: {lang: 0x416, script: 0x57, flags: 0x0},
-	272: {lang: 0x347, script: 0x57, flags: 0x0},
-	273: {lang: 0x43, script: 0x2, flags: 0x1},
-	275: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	276: {lang: 0x15e, script: 0x57, flags: 0x0},
-	277: {lang: 0x429, script: 0x57, flags: 0x0},
-	278: {lang: 0x367, script: 0x57, flags: 0x0},
-	280: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	282: {lang: 0x13e, script: 0x57, flags: 0x0},
-	284: {lang: 0x45, script: 0x2, flags: 0x1},
-	288: {lang: 0x15e, script: 0x57, flags: 0x0},
-	289: {lang: 0x15e, script: 0x57, flags: 0x0},
-	290: {lang: 0x47, script: 0x2, flags: 0x1},
-	291: {lang: 0x49, script: 0x3, flags: 0x1},
-	292: {lang: 0x4c, script: 0x2, flags: 0x1},
-	293: {lang: 0x477, script: 0x57, flags: 0x0},
-	294: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	295: {lang: 0x476, script: 0x57, flags: 0x0},
-	296: {lang: 0x4e, script: 0x2, flags: 0x1},
-	297: {lang: 0x482, script: 0x57, flags: 0x0},
-	299: {lang: 0x50, script: 0x4, flags: 0x1},
-	301: {lang: 0x4a0, script: 0x57, flags: 0x0},
-	302: {lang: 0x54, script: 0x2, flags: 0x1},
-	303: {lang: 0x445, script: 0x57, flags: 0x0},
-	304: {lang: 0x56, script: 0x3, flags: 0x1},
-	305: {lang: 0x445, script: 0x57, flags: 0x0},
-	309: {lang: 0x512, script: 0x3b, flags: 0x2},
-	310: {lang: 0x13e, script: 0x57, flags: 0x0},
-	311: {lang: 0x4bc, script: 0x57, flags: 0x0},
-	312: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	315: {lang: 0x13e, script: 0x57, flags: 0x0},
-	318: {lang: 0x4c3, script: 0x57, flags: 0x0},
-	319: {lang: 0x8a, script: 0x57, flags: 0x0},
-	320: {lang: 0x15e, script: 0x57, flags: 0x0},
-	322: {lang: 0x41b, script: 0x57, flags: 0x0},
-	333: {lang: 0x59, script: 0x2, flags: 0x1},
-	350: {lang: 0x3a, script: 0x5, flags: 0x0},
-	351: {lang: 0x5b, script: 0x2, flags: 0x1},
-	356: {lang: 0x423, script: 0x57, flags: 0x0},
-}
-
-// likelyRegionList holds lists info associated with likelyRegion.
-// Size: 372 bytes, 93 elements
-var likelyRegionList = [93]likelyLangScript{
-	0:  {lang: 0x148, script: 0x5, flags: 0x0},
-	1:  {lang: 0x476, script: 0x57, flags: 0x0},
-	2:  {lang: 0x431, script: 0x57, flags: 0x0},
-	3:  {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	4:  {lang: 0x1d7, script: 0x8, flags: 0x0},
-	5:  {lang: 0x274, script: 0x57, flags: 0x0},
-	6:  {lang: 0xb7, script: 0x57, flags: 0x0},
-	7:  {lang: 0x432, script: 0x1f, flags: 0x0},
-	8:  {lang: 0x12d, script: 0xe0, flags: 0x0},
-	9:  {lang: 0x351, script: 0x21, flags: 0x0},
-	10: {lang: 0x529, script: 0x38, flags: 0x0},
-	11: {lang: 0x4ac, script: 0x5, flags: 0x0},
-	12: {lang: 0x523, script: 0x57, flags: 0x0},
-	13: {lang: 0x29a, script: 0xdf, flags: 0x0},
-	14: {lang: 0x136, script: 0x31, flags: 0x0},
-	15: {lang: 0x48a, script: 0x57, flags: 0x0},
-	16: {lang: 0x3a, script: 0x5, flags: 0x0},
-	17: {lang: 0x15e, script: 0x57, flags: 0x0},
-	18: {lang: 0x27, script: 0x29, flags: 0x0},
-	19: {lang: 0x139, script: 0x57, flags: 0x0},
-	20: {lang: 0x26a, script: 0x5, flags: 0x2},
-	21: {lang: 0x512, script: 0x3b, flags: 0x2},
-	22: {lang: 0x210, script: 0x2b, flags: 0x0},
-	23: {lang: 0x5, script: 0x1f, flags: 0x0},
-	24: {lang: 0x274, script: 0x57, flags: 0x0},
-	25: {lang: 0x136, script: 0x31, flags: 0x0},
-	26: {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	27: {lang: 0x1e1, script: 0x57, flags: 0x0},
-	28: {lang: 0x31f, script: 0x5, flags: 0x0},
-	29: {lang: 0x1be, script: 0x21, flags: 0x0},
-	30: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	31: {lang: 0x236, script: 0x72, flags: 0x0},
-	32: {lang: 0x148, script: 0x5, flags: 0x0},
-	33: {lang: 0x476, script: 0x57, flags: 0x0},
-	34: {lang: 0x24a, script: 0x4b, flags: 0x0},
-	35: {lang: 0xe6, script: 0x5, flags: 0x0},
-	36: {lang: 0x226, script: 0xdf, flags: 0x0},
-	37: {lang: 0x3a, script: 0x5, flags: 0x0},
-	38: {lang: 0x15e, script: 0x57, flags: 0x0},
-	39: {lang: 0x2b8, script: 0x54, flags: 0x0},
-	40: {lang: 0x226, script: 0xdf, flags: 0x0},
-	41: {lang: 0x3a, script: 0x5, flags: 0x0},
-	42: {lang: 0x15e, script: 0x57, flags: 0x0},
-	43: {lang: 0x3dc, script: 0x57, flags: 0x0},
-	44: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	45: {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	46: {lang: 0x431, script: 0x57, flags: 0x0},
-	47: {lang: 0x331, script: 0x72, flags: 0x0},
-	48: {lang: 0x213, script: 0x57, flags: 0x0},
-	49: {lang: 0x30b, script: 0x1f, flags: 0x0},
-	50: {lang: 0x242, script: 0x5, flags: 0x0},
-	51: {lang: 0x529, script: 0x39, flags: 0x0},
-	52: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	53: {lang: 0x3a, script: 0x5, flags: 0x0},
-	54: {lang: 0x15e, script: 0x57, flags: 0x0},
-	55: {lang: 0x2ed, script: 0x57, flags: 0x0},
-	56: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	57: {lang: 0x88, script: 0x21, flags: 0x0},
-	58: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	59: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	60: {lang: 0xbe, script: 0x21, flags: 0x0},
-	61: {lang: 0x3dc, script: 0x57, flags: 0x0},
-	62: {lang: 0x7e, script: 0x1f, flags: 0x0},
-	63: {lang: 0x3e2, script: 0x1f, flags: 0x0},
-	64: {lang: 0x267, script: 0x57, flags: 0x0},
-	65: {lang: 0x444, script: 0x57, flags: 0x0},
-	66: {lang: 0x512, script: 0x3b, flags: 0x0},
-	67: {lang: 0x412, script: 0x57, flags: 0x0},
-	68: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	69: {lang: 0x3a, script: 0x5, flags: 0x0},
-	70: {lang: 0x15e, script: 0x57, flags: 0x0},
-	71: {lang: 0x15e, script: 0x57, flags: 0x0},
-	72: {lang: 0x35, script: 0x5, flags: 0x0},
-	73: {lang: 0x46b, script: 0xdf, flags: 0x0},
-	74: {lang: 0x2ec, script: 0x5, flags: 0x0},
-	75: {lang: 0x30f, script: 0x72, flags: 0x0},
-	76: {lang: 0x467, script: 0x1f, flags: 0x0},
-	77: {lang: 0x148, script: 0x5, flags: 0x0},
-	78: {lang: 0x3a, script: 0x5, flags: 0x0},
-	79: {lang: 0x15e, script: 0x57, flags: 0x0},
-	80: {lang: 0x48a, script: 0x57, flags: 0x0},
-	81: {lang: 0x58, script: 0x5, flags: 0x0},
-	82: {lang: 0x219, script: 0x1f, flags: 0x0},
-	83: {lang: 0x81, script: 0x31, flags: 0x0},
-	84: {lang: 0x529, script: 0x39, flags: 0x0},
-	85: {lang: 0x48c, script: 0x57, flags: 0x0},
-	86: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	87: {lang: 0x512, script: 0x3b, flags: 0x0},
-	88: {lang: 0x3b3, script: 0x57, flags: 0x0},
-	89: {lang: 0x431, script: 0x57, flags: 0x0},
-	90: {lang: 0x432, script: 0x1f, flags: 0x0},
-	91: {lang: 0x15e, script: 0x57, flags: 0x0},
-	92: {lang: 0x446, script: 0x5, flags: 0x0},
-}
-
-type likelyTag struct {
-	lang   uint16
-	region uint16
-	script uint8
-}
-
-// Size: 198 bytes, 33 elements
-var likelyRegionGroup = [33]likelyTag{
-	1:  {lang: 0x139, region: 0xd6, script: 0x57},
-	2:  {lang: 0x139, region: 0x135, script: 0x57},
-	3:  {lang: 0x3c0, region: 0x41, script: 0x57},
-	4:  {lang: 0x139, region: 0x2f, script: 0x57},
-	5:  {lang: 0x139, region: 0xd6, script: 0x57},
-	6:  {lang: 0x13e, region: 0xcf, script: 0x57},
-	7:  {lang: 0x445, region: 0x12f, script: 0x57},
-	8:  {lang: 0x3a, region: 0x6b, script: 0x5},
-	9:  {lang: 0x445, region: 0x4b, script: 0x57},
-	10: {lang: 0x139, region: 0x161, script: 0x57},
-	11: {lang: 0x139, region: 0x135, script: 0x57},
-	12: {lang: 0x139, region: 0x135, script: 0x57},
-	13: {lang: 0x13e, region: 0x59, script: 0x57},
-	14: {lang: 0x529, region: 0x53, script: 0x38},
-	15: {lang: 0x1be, region: 0x99, script: 0x21},
-	16: {lang: 0x1e1, region: 0x95, script: 0x57},
-	17: {lang: 0x1f9, region: 0x9e, script: 0x57},
-	18: {lang: 0x139, region: 0x2f, script: 0x57},
-	19: {lang: 0x139, region: 0xe6, script: 0x57},
-	20: {lang: 0x139, region: 0x8a, script: 0x57},
-	21: {lang: 0x41b, region: 0x142, script: 0x57},
-	22: {lang: 0x529, region: 0x53, script: 0x38},
-	23: {lang: 0x4bc, region: 0x137, script: 0x57},
-	24: {lang: 0x3a, region: 0x108, script: 0x5},
-	25: {lang: 0x3e2, region: 0x106, script: 0x1f},
-	26: {lang: 0x3e2, region: 0x106, script: 0x1f},
-	27: {lang: 0x139, region: 0x7b, script: 0x57},
-	28: {lang: 0x10d, region: 0x60, script: 0x57},
-	29: {lang: 0x139, region: 0xd6, script: 0x57},
-	30: {lang: 0x13e, region: 0x1f, script: 0x57},
-	31: {lang: 0x139, region: 0x9a, script: 0x57},
-	32: {lang: 0x139, region: 0x7b, script: 0x57},
-}
-
-// Size: 358 bytes, 358 elements
-var regionToGroups = [358]uint8{
+// Size: 357 bytes, 357 elements
+var regionToGroups = [357]uint8{
 	// Entry 0 - 3F
 	0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04,
 	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00,
@@ -3343,7 +180,7 @@
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00,
 }
 
 // Size: 18 bytes, 3 elements
@@ -3546,141 +383,4 @@
 	14: {lang: 0x529, script: 0x39, group: 0x80, distance: 0x5},
 }
 
-// Size: 264 bytes, 33 elements
-var regionContainment = [33]uint64{
-	// Entry 0 - 1F
-	0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
-	0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
-	0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
-	0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
-	0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
-	0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
-	0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
-	0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
-	// Entry 20 - 3F
-	0x0000000100000000,
-}
-
-// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
-// where each set holds all groupings that are directly connected in a region
-// containment graph.
-// Size: 358 bytes, 358 elements
-var regionInclusion = [358]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
-	0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
-	0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
-	0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
-	0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
-	0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
-	0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
-	0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
-	// Entry 40 - 7F
-	0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
-	0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
-	0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
-	0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
-	0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
-	0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
-	0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
-	0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
-	// Entry 80 - BF
-	0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
-	0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
-	0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
-	0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
-	0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
-	0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
-	0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
-	0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
-	// Entry C0 - FF
-	0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
-	0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
-	0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
-	0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
-	0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
-	0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
-	0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
-	// Entry 100 - 13F
-	0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
-	0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
-	0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
-	0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
-	0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
-	0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
-	0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
-	0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
-	// Entry 140 - 17F
-	0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
-	0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
-}
-
-// regionInclusionBits is an array of bit vectors where every vector represents
-// a set of region groupings.  These sets are used to compute the distance
-// between two regions for the purpose of language matching.
-// Size: 584 bytes, 73 elements
-var regionInclusionBits = [73]uint64{
-	// Entry 0 - 1F
-	0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
-	0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
-	0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
-	0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
-	0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
-	0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
-	0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
-	0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
-	// Entry 20 - 3F
-	0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
-	0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
-	0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
-	0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
-	0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
-	0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
-	0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
-	0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
-	// Entry 40 - 5F
-	0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
-	0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
-	0x0000000102020001,
-}
-
-// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
-// all groups that are reachable from the groups set in the respective entry.
-// Size: 73 bytes, 73 elements
-var regionInclusionNext = [73]uint8{
-	// Entry 0 - 3F
-	0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
-	0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
-	0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
-	0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
-	0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
-	0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
-	0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
-	0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
-	// Entry 40 - 7F
-	0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
-	0x43,
-}
-
-type parentRel struct {
-	lang       uint16
-	script     uint8
-	maxScript  uint8
-	toRegion   uint16
-	fromRegion []uint16
-}
-
-// Size: 414 bytes, 5 elements
-var parents = [5]parentRel{
-	0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
-	1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
-	2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
-	3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
-	4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
-}
-
-// Total table size 27238 bytes (26KiB); checksum: C9BBE4D5
+// Total table size 1351 bytes (1KiB); checksum: B5A6F1BC
diff --git a/language/tags.go b/language/tags.go
index de30155..1d1b7f8 100644
--- a/language/tags.go
+++ b/language/tags.go
@@ -61,83 +61,85 @@
 
 	Und Tag = Tag{}
 
-	Afrikaans            Tag = Tag{lang: _af}                //  af
-	Amharic              Tag = Tag{lang: _am}                //  am
-	Arabic               Tag = Tag{lang: _ar}                //  ar
-	ModernStandardArabic Tag = Tag{lang: _ar, region: _001}  //  ar-001
-	Azerbaijani          Tag = Tag{lang: _az}                //  az
-	Bulgarian            Tag = Tag{lang: _bg}                //  bg
-	Bengali              Tag = Tag{lang: _bn}                //  bn
-	Catalan              Tag = Tag{lang: _ca}                //  ca
-	Czech                Tag = Tag{lang: _cs}                //  cs
-	Danish               Tag = Tag{lang: _da}                //  da
-	German               Tag = Tag{lang: _de}                //  de
-	Greek                Tag = Tag{lang: _el}                //  el
-	English              Tag = Tag{lang: _en}                //  en
-	AmericanEnglish      Tag = Tag{lang: _en, region: _US}   //  en-US
-	BritishEnglish       Tag = Tag{lang: _en, region: _GB}   //  en-GB
-	Spanish              Tag = Tag{lang: _es}                //  es
-	EuropeanSpanish      Tag = Tag{lang: _es, region: _ES}   //  es-ES
-	LatinAmericanSpanish Tag = Tag{lang: _es, region: _419}  //  es-419
-	Estonian             Tag = Tag{lang: _et}                //  et
-	Persian              Tag = Tag{lang: _fa}                //  fa
-	Finnish              Tag = Tag{lang: _fi}                //  fi
-	Filipino             Tag = Tag{lang: _fil}               //  fil
-	French               Tag = Tag{lang: _fr}                //  fr
-	CanadianFrench       Tag = Tag{lang: _fr, region: _CA}   //  fr-CA
-	Gujarati             Tag = Tag{lang: _gu}                //  gu
-	Hebrew               Tag = Tag{lang: _he}                //  he
-	Hindi                Tag = Tag{lang: _hi}                //  hi
-	Croatian             Tag = Tag{lang: _hr}                //  hr
-	Hungarian            Tag = Tag{lang: _hu}                //  hu
-	Armenian             Tag = Tag{lang: _hy}                //  hy
-	Indonesian           Tag = Tag{lang: _id}                //  id
-	Icelandic            Tag = Tag{lang: _is}                //  is
-	Italian              Tag = Tag{lang: _it}                //  it
-	Japanese             Tag = Tag{lang: _ja}                //  ja
-	Georgian             Tag = Tag{lang: _ka}                //  ka
-	Kazakh               Tag = Tag{lang: _kk}                //  kk
-	Khmer                Tag = Tag{lang: _km}                //  km
-	Kannada              Tag = Tag{lang: _kn}                //  kn
-	Korean               Tag = Tag{lang: _ko}                //  ko
-	Kirghiz              Tag = Tag{lang: _ky}                //  ky
-	Lao                  Tag = Tag{lang: _lo}                //  lo
-	Lithuanian           Tag = Tag{lang: _lt}                //  lt
-	Latvian              Tag = Tag{lang: _lv}                //  lv
-	Macedonian           Tag = Tag{lang: _mk}                //  mk
-	Malayalam            Tag = Tag{lang: _ml}                //  ml
-	Mongolian            Tag = Tag{lang: _mn}                //  mn
-	Marathi              Tag = Tag{lang: _mr}                //  mr
-	Malay                Tag = Tag{lang: _ms}                //  ms
-	Burmese              Tag = Tag{lang: _my}                //  my
-	Nepali               Tag = Tag{lang: _ne}                //  ne
-	Dutch                Tag = Tag{lang: _nl}                //  nl
-	Norwegian            Tag = Tag{lang: _no}                //  no
-	Punjabi              Tag = Tag{lang: _pa}                //  pa
-	Polish               Tag = Tag{lang: _pl}                //  pl
-	Portuguese           Tag = Tag{lang: _pt}                //  pt
-	BrazilianPortuguese  Tag = Tag{lang: _pt, region: _BR}   //  pt-BR
-	EuropeanPortuguese   Tag = Tag{lang: _pt, region: _PT}   //  pt-PT
-	Romanian             Tag = Tag{lang: _ro}                //  ro
-	Russian              Tag = Tag{lang: _ru}                //  ru
-	Sinhala              Tag = Tag{lang: _si}                //  si
-	Slovak               Tag = Tag{lang: _sk}                //  sk
-	Slovenian            Tag = Tag{lang: _sl}                //  sl
-	Albanian             Tag = Tag{lang: _sq}                //  sq
-	Serbian              Tag = Tag{lang: _sr}                //  sr
-	SerbianLatin         Tag = Tag{lang: _sr, script: _Latn} //  sr-Latn
-	Swedish              Tag = Tag{lang: _sv}                //  sv
-	Swahili              Tag = Tag{lang: _sw}                //  sw
-	Tamil                Tag = Tag{lang: _ta}                //  ta
-	Telugu               Tag = Tag{lang: _te}                //  te
-	Thai                 Tag = Tag{lang: _th}                //  th
-	Turkish              Tag = Tag{lang: _tr}                //  tr
-	Ukrainian            Tag = Tag{lang: _uk}                //  uk
-	Urdu                 Tag = Tag{lang: _ur}                //  ur
-	Uzbek                Tag = Tag{lang: _uz}                //  uz
-	Vietnamese           Tag = Tag{lang: _vi}                //  vi
-	Chinese              Tag = Tag{lang: _zh}                //  zh
-	SimplifiedChinese    Tag = Tag{lang: _zh, script: _Hans} //  zh-Hans
-	TraditionalChinese   Tag = Tag{lang: _zh, script: _Hant} //  zh-Hant
-	Zulu                 Tag = Tag{lang: _zu}                //  zu
+	// TODO: use compact tags once the transition is completed.
+
+	Afrikaans            Tag = Raw.MustParse("af")      // Tag{lang: _af}                //  af
+	Amharic              Tag = Raw.MustParse("am")      // Tag{lang: _am}                //  am
+	Arabic               Tag = Raw.MustParse("ar")      // Tag{lang: _ar}                //  ar
+	ModernStandardArabic Tag = Raw.MustParse("ar-001")  // Tag{lang: _ar, region: _001}  //  ar-001
+	Azerbaijani          Tag = Raw.MustParse("az")      // Tag{lang: _az}                //  az
+	Bulgarian            Tag = Raw.MustParse("bg")      // Tag{lang: _bg}                //  bg
+	Bengali              Tag = Raw.MustParse("bn")      // Tag{lang: _bn}                //  bn
+	Catalan              Tag = Raw.MustParse("ca")      // Tag{lang: _ca}                //  ca
+	Czech                Tag = Raw.MustParse("cs")      // Tag{lang: _cs}                //  cs
+	Danish               Tag = Raw.MustParse("da")      // Tag{lang: _da}                //  da
+	German               Tag = Raw.MustParse("de")      // Tag{lang: _de}                //  de
+	Greek                Tag = Raw.MustParse("el")      // Tag{lang: _el}                //  el
+	English              Tag = Raw.MustParse("en")      // Tag{lang: _en}                //  en
+	AmericanEnglish      Tag = Raw.MustParse("en-US")   // Tag{lang: _en, region: _US}   //  en-US
+	BritishEnglish       Tag = Raw.MustParse("en-GB")   // Tag{lang: _en, region: _GB}   //  en-GB
+	Spanish              Tag = Raw.MustParse("es")      // Tag{lang: _es}                //  es
+	EuropeanSpanish      Tag = Raw.MustParse("es-ES")   // Tag{lang: _es, region: _ES}   //  es-ES
+	LatinAmericanSpanish Tag = Raw.MustParse("es-419")  // Tag{lang: _es, region: _419}  //  es-419
+	Estonian             Tag = Raw.MustParse("et")      // Tag{lang: _et}                //  et
+	Persian              Tag = Raw.MustParse("fa")      // Tag{lang: _fa}                //  fa
+	Finnish              Tag = Raw.MustParse("fi")      // Tag{lang: _fi}                //  fi
+	Filipino             Tag = Raw.MustParse("fil")     // Tag{lang: _fil}               //  fil
+	French               Tag = Raw.MustParse("fr")      // Tag{lang: _fr}                //  fr
+	CanadianFrench       Tag = Raw.MustParse("fr-CA")   // Tag{lang: _fr, region: _CA}   //  fr-CA
+	Gujarati             Tag = Raw.MustParse("gu")      // Tag{lang: _gu}                //  gu
+	Hebrew               Tag = Raw.MustParse("he")      // Tag{lang: _he}                //  he
+	Hindi                Tag = Raw.MustParse("hi")      // Tag{lang: _hi}                //  hi
+	Croatian             Tag = Raw.MustParse("hr")      // Tag{lang: _hr}                //  hr
+	Hungarian            Tag = Raw.MustParse("hu")      // Tag{lang: _hu}                //  hu
+	Armenian             Tag = Raw.MustParse("hy")      // Tag{lang: _hy}                //  hy
+	Indonesian           Tag = Raw.MustParse("id")      // Tag{lang: _id}                //  id
+	Icelandic            Tag = Raw.MustParse("is")      // Tag{lang: _is}                //  is
+	Italian              Tag = Raw.MustParse("it")      // Tag{lang: _it}                //  it
+	Japanese             Tag = Raw.MustParse("ja")      // Tag{lang: _ja}                //  ja
+	Georgian             Tag = Raw.MustParse("ka")      // Tag{lang: _ka}                //  ka
+	Kazakh               Tag = Raw.MustParse("kk")      // Tag{lang: _kk}                //  kk
+	Khmer                Tag = Raw.MustParse("km")      // Tag{lang: _km}                //  km
+	Kannada              Tag = Raw.MustParse("kn")      // Tag{lang: _kn}                //  kn
+	Korean               Tag = Raw.MustParse("ko")      // Tag{lang: _ko}                //  ko
+	Kirghiz              Tag = Raw.MustParse("ky")      // Tag{lang: _ky}                //  ky
+	Lao                  Tag = Raw.MustParse("lo")      // Tag{lang: _lo}                //  lo
+	Lithuanian           Tag = Raw.MustParse("lt")      // Tag{lang: _lt}                //  lt
+	Latvian              Tag = Raw.MustParse("lv")      // Tag{lang: _lv}                //  lv
+	Macedonian           Tag = Raw.MustParse("mk")      // Tag{lang: _mk}                //  mk
+	Malayalam            Tag = Raw.MustParse("ml")      // Tag{lang: _ml}                //  ml
+	Mongolian            Tag = Raw.MustParse("mn")      // Tag{lang: _mn}                //  mn
+	Marathi              Tag = Raw.MustParse("mr")      // Tag{lang: _mr}                //  mr
+	Malay                Tag = Raw.MustParse("ms")      // Tag{lang: _ms}                //  ms
+	Burmese              Tag = Raw.MustParse("my")      // Tag{lang: _my}                //  my
+	Nepali               Tag = Raw.MustParse("ne")      // Tag{lang: _ne}                //  ne
+	Dutch                Tag = Raw.MustParse("nl")      // Tag{lang: _nl}                //  nl
+	Norwegian            Tag = Raw.MustParse("no")      // Tag{lang: _no}                //  no
+	Punjabi              Tag = Raw.MustParse("pa")      // Tag{lang: _pa}                //  pa
+	Polish               Tag = Raw.MustParse("pl")      // Tag{lang: _pl}                //  pl
+	Portuguese           Tag = Raw.MustParse("pt")      // Tag{lang: _pt}                //  pt
+	BrazilianPortuguese  Tag = Raw.MustParse("pt-BR")   // Tag{lang: _pt, region: _BR}   //  pt-BR
+	EuropeanPortuguese   Tag = Raw.MustParse("pt-PT")   // Tag{lang: _pt, region: _PT}   //  pt-PT
+	Romanian             Tag = Raw.MustParse("ro")      // Tag{lang: _ro}                //  ro
+	Russian              Tag = Raw.MustParse("ru")      // Tag{lang: _ru}                //  ru
+	Sinhala              Tag = Raw.MustParse("si")      // Tag{lang: _si}                //  si
+	Slovak               Tag = Raw.MustParse("sk")      // Tag{lang: _sk}                //  sk
+	Slovenian            Tag = Raw.MustParse("sl")      // Tag{lang: _sl}                //  sl
+	Albanian             Tag = Raw.MustParse("sq")      // Tag{lang: _sq}                //  sq
+	Serbian              Tag = Raw.MustParse("sr")      // Tag{lang: _sr}                //  sr
+	SerbianLatin         Tag = Raw.MustParse("sr-Latn") // Tag{lang: _sr, script: _Latn} //  sr-Latn
+	Swedish              Tag = Raw.MustParse("sv")      // Tag{lang: _sv}                //  sv
+	Swahili              Tag = Raw.MustParse("sw")      // Tag{lang: _sw}                //  sw
+	Tamil                Tag = Raw.MustParse("ta")      // Tag{lang: _ta}                //  ta
+	Telugu               Tag = Raw.MustParse("te")      // Tag{lang: _te}                //  te
+	Thai                 Tag = Raw.MustParse("th")      // Tag{lang: _th}                //  th
+	Turkish              Tag = Raw.MustParse("tr")      // Tag{lang: _tr}                //  tr
+	Ukrainian            Tag = Raw.MustParse("uk")      // Tag{lang: _uk}                //  uk
+	Urdu                 Tag = Raw.MustParse("ur")      // Tag{lang: _ur}                //  ur
+	Uzbek                Tag = Raw.MustParse("uz")      // Tag{lang: _uz}                //  uz
+	Vietnamese           Tag = Raw.MustParse("vi")      // Tag{lang: _vi}                //  vi
+	Chinese              Tag = Raw.MustParse("zh")      // Tag{lang: _zh}                //  zh
+	SimplifiedChinese    Tag = Raw.MustParse("zh-Hans") // Tag{lang: _zh, script: _Hans} //  zh-Hans
+	TraditionalChinese   Tag = Raw.MustParse("zh-Hant") // Tag{lang: _zh, script: _Hant} //  zh-Hant
+	Zulu                 Tag = Raw.MustParse("zu")      // Tag{lang: _zu}                //  zu
 )