blob: 25674d1ad84131f28466b8ee5f8e75cd07f6505c [file] [log] [blame]
// generated by go run gen.go; DO NOT EDIT
package publicsuffix
const version = "publicsuffix.org's public_suffix_list.dat, git revision 0e2a405f597a3c1be456d704b42bdd5e0d4954bb (2019-02-21T09:23:55Z)"
const (
nodesBitsChildren = 10
nodesBitsICANN = 1
nodesBitsTextOffset = 15
nodesBitsTextLength = 6
childrenBitsWildcard = 1
childrenBitsNodeType = 2
childrenBitsHi = 14
childrenBitsLo = 14
)
const (
nodeTypeNormal = 0
nodeTypeException = 1
nodeTypeParentOnly = 2
)
// numTLD is the number of top level domains.
const numTLD = 1541
// Text is the combined text of all labels.
const text = "0emmafann-arboretumbriamallamaceiobirabogadodgeiseiyoichippubets" +
"ubetsugarugbydgoszczecinemaceratabuseating-organicbcieszyn4t3l3p" +
"0rtargets-itargivestbytemark120001wwwebredirectmemsettsupportarn" +
"obrzegyptianatuurwetenschappenaumburg120389guacuiababia-goraclea" +
"ningroks-theatreeastcoastaldefenceatonsberggfarmerseinebinagisob" +
"etsumidatlanticaseihicampobassociatest-iservecounterstrikebinord" +
"re-landd-dnshome-webservercelliguriagrocerybnikeisenbahnaval-d-a" +
"osta-valleyokosukanzakiyokawarajudygarlanddnslivelanddnss3-ap-so" +
"uth-16-baltimore-og-romsdalipayboltarumizusawabruzzoologicalvink" +
"lein-addrammenuernbergdyniaetnadexeterepbodynamisches-dns3-ap-no" +
"rtheast-1337bmwedeploybnpparibaselburgleezebnrwegroweibolognagat" +
"orodoybomloabathsbcheltenham-radio-openairbusantiquest-a-la-mais" +
"ondre-landroidrayddnsfreebox-osascoli-picenordlandraydnsupdaterb" +
"ondrivefsnillfjordrobaknoluoktachikawakembuchikumagayagawakkanai" +
"betsubamericanfamilydscloudcontrolapplicationcloudaccesscambridg" +
"estoneat-urlimoliserniabonnishikatsuragit-repos3-website-ap-sout" +
"heast-2bookingliwiceboomladbrokes3-website-eu-west-1boschaeffler" +
"dalvdalaskanittedallasalleaseekloges3-website-sa-east-1bostikarm" +
"oybostonakijinsekikogentinglobalashovhachinohedmarkarpaczeladzlg" +
"loboavistaprintelligencebotanicalgardenishikawazukamitsuebotanic" +
"gardenishimerabotanybouncemerckmsdnipropetrovskjervoyagebounty-f" +
"ullensakerryproperties3-website-us-east-1boutiquebechernigovernm" +
"entjeldsundruduns3-website-us-west-1bozen-sudtirolinkyard-cloudf" +
"unctions3-website-us-west-2bozen-suedtirolivornobplacedekagamino" +
"rd-odalwaysdatabaseballangenoamishirasatobishimaintenancertmgret" +
"agajobojindustriesteamfamberkeleybrandywinevalleybrasiliabrindis" +
"ibenikinderoybristoloseyouriparliamentjmaxxxboxenapponazure-mobi" +
"lebritishcolumbialowiezachpomorskienishinomiyashironobroadcastle" +
"btimnetzparmatta-varjjatjomemorialomzaporizhzhegurinfinitintuitj" +
"xfinitybroadwaybroke-itkmaxxjavald-aostaples5ybrokerbronnoysundu" +
"pontariodejaneirogersakyotanabellunombresciabrothermesaverdealst" +
"ahaugesunderseaportsinfolldalondrinaplesalangenishinoomotegobrow" +
"sersafetymarketsalondonetskaruizawabrumunddalorenskoglogoweirbru" +
"nelasticbeanstalkarumaifarmsteadurbanamexnetlifyinuyamashinatsuk" +
"igatakarazukamakurazakiwakunigamiharuconnectksatxn--0trq7p7nnish" +
"inoshimatsushigebrusselsaltdalotenkawabruxellesaludurhamburglopp" +
"enzaolbia-tempio-olbiatempioolbialystokkepnodumetlifeinsurancebr" +
"yansklepparocherkasyno-dsalvadordalibabalsan-sudtirollagdenesnaa" +
"seralingenkainanaejrietisalatinabenonichernihivgubarclaycards3-e" +
"u-west-2brynewjerseybusinessebykleclerchernivtsiciliabuskerudine" +
"wmexicoalottebuzentsujiiebuzzwfarsundyndns-at-homedepotenzamamid" +
"sundyndns-at-workinggrouparsalzburglugmbhartiffanybwhalingminaka" +
"michiharabzhitomirumalborkdalottokorozawabzzcolognextdirectozsde" +
"ltaiwanairforcechireadthedocscappgafannakadomarinedre-eikercolon" +
"ialwilliamsburgrongacoloradoplateaudiocolumbusheycommunitysvardo" +
"haruovatrani-andria-barletta-trani-andriacomobaracomparemarkerry" +
"hotelsannancompute-1computerhistoryofscience-fictioncomsecurityt" +
"acticsannohelpagesanokashiwaracondoshichinohealth-carereforminam" +
"idaitomandalucerneconferenceconstructionconsuladollsantabarbarac" +
"onsultanthropologyconsultingrossetouchihayaakasakawaharacontactr" +
"aniandriabarlettatraniandriacontagematsubaracontemporaryarteduca" +
"tionalchikugodaddyn-vpndnsantacruzsantafedjejuifminamiechizencon" +
"tractorskenconventureshinodearthdfcbankashiwazakiyosunndalukowii" +
"heyakagecookingchannelsdvrdnsdojoetsuwanouchikujogaszkolahppiace" +
"nzagancooluroycooperativano-frankivskolegallocus-2copenhagencycl" +
"opedichitachinakagawassamukawataricohdatingmodellingmxn--11b4c3d" +
"yndns-freeboxosloftranakasatsunairguardiannefrankfurtmpartinzais" +
"-a-candidatecorsicafederationcorvettemasekasukabedzin-berlindasc" +
"olipicenogataijis-a-chefashioncosenzakopanexus-3cosidnsfor-bette" +
"r-thanawatchesantamariakecostumedicinakamurataitogitsuldalutskas" +
"umigaurawa-mazowszextraspace-to-rentalstomakomaibaracouchpotatof" +
"riesantoandreamhostersanukis-a-conservativegarsheis-a-cpadualsta" +
"ckasuyameiwamarugame-hostrolekaminokawanishiaizubangecounciluxem" +
"bourgroundhandlingroznycouponsaobernardocoursesaogoncartoonartde" +
"cologiacq-acranbrookuwanalyticsaotomeloyalistoragecreditcardyndn" +
"s-wikirkenesapporocreditunioncremonashgabadaddjaguarqhachiojiyah" +
"oooshikamaishimodatecrewildlifedorainfracloudcontrolledogawarabi" +
"komaezakirunordreisa-geekaszubycricketrzyncrimeast-kazakhstanang" +
"ercrotonecrownipasadenaritakurashikis-a-cubicle-slavellinotaires" +
"taurantranoycrsvpassagensardegnarusawacruisesardiniacryptonomich" +
"igangwoncuisinellair-traffic-controlleyculturalcenternopilawawil" +
"liamhilluxurycuneocupcakecuritibaghdadyndns-workisboringrpasseng" +
"er-associationcxn--12c1fe0bradescorporationcyberlevagangaviikano" +
"njis-a-democratransportecymrussiacyonabaruminamifuranocyouthewor" +
"kpccwinbarclays3-eu-west-3ferrarissagamiharaferreroticanonoichin" +
"omiyakefetsundyndns1fguitarsaudafhvalerfidontexistmein-iservebee" +
"rfieldynnsarluzernfigueresinstagingujoinvilleitungsenfilateliafi" +
"legear-audnedalnfilegear-deatnurembergulenfilegear-gbizfilegear-" +
"iefilegear-jpmorganfilegear-sgunmapartmentsauheradynservebbsarps" +
"borgruefilminamimakis-a-doctorayfinalfinancefineartsavannahgafin" +
"landynufcfanfinnoyfirebaseapplinzis-a-financialadvisor-aurdalfir" +
"enzefirestonefirmdalegojomedio-campidano-mediocampidanomediofish" +
"ingokasells-itravelchannelfitjarfitnessettlementravelersinsuranc" +
"efjalerflesberguovdageaidnulvikatowiceflickragerotikakamigaharaf" +
"lightsaves-the-whalessandria-trani-barletta-andriatranibarlettaa" +
"ndriaflirflogintogoldpoint2thisamitsukefloraflorencefloridattowe" +
"bcampinashikiminohostfoldnavyfloripaderbornfloristanohatajiritto" +
"guraflorokunohealthcareersavonarutomobellevuelosangelesjabbottrd" +
"ynv6flowersaxofltrentin-sud-tirolflynnhosting-clusterflynnhubarg" +
"ainstantcloudeitysfjordiscoveryolasiteu-4fndynvpnplus-4for-ourfo" +
"r-somedizinhistorischeschoenbrunnfor-theaterforexrothachirogatak" +
"amatsukawaforgotdnschokokekschokoladenforli-cesena-forlicesenafo" +
"rlikescandynaliashorokanaieforsaleikangerforsandasuololfortalfor" +
"tmissoulajollamericanexpressexyfortworthadanorthwesternmutualfor" +
"umzfosnescholarshipschoolfotarivnefoxfordebianfozorafredrikstadt" +
"vschulefreeddnsgeekgalaxyfreedesktoperauniteroizumizakiryuohkura" +
"freemasonryfreesitevadsoccertificationfreetlschwarzgwangjuniperf" +
"reiburgushikamifuranorth-kazakhstanfreightrentin-sudtirolfreseni" +
"uscountryestateofdelawarezzoologyfribourgwiddleksvikatsushikabee" +
"ldengeluidyroyrvikinguidegreefriuli-v-giuliafriuli-ve-giuliafriu" +
"li-vegiuliafriuli-venezia-giuliafriuli-veneziagiuliafriuli-vgiul" +
"iafriuliv-giuliafriulive-giuliafriulivegiuliafriulivenezia-giuli" +
"afriuliveneziagiuliafriulivgiuliafrlfroganschweizfrognfrolandfro" +
"m-akrehamnfrom-alfrom-arfrom-azfrom-capebretonamicrosoftbankatsu" +
"yamarumorimachidafrom-codyn-o-saurlandesciencecentersciencehisto" +
"ryfrom-ctrentin-sued-tirolfrom-dchitosetogakushimotoganewyorkshi" +
"recifedexhibitionishiokoppegardyndns-homednsampalacefrom-dedyn-b" +
"erlincolnfrom-flanderscientistordalfrom-gausdalfrom-hichisochild" +
"rensgardenfrom-iafrom-idfrom-ilfrom-in-brbarreauctionflfanfshost" +
"rowiecasertaipeigersundishakotanhktattooddaustrheimatunduhrennes" +
"oyokotebizenakatombetsumitakagiizehimejibigawaurskog-holandingje" +
"mnes3-ap-southeast-2ix4432-bambleborkangereportashkentatamotors3" +
"-ap-northeast-2from-kscjohnsonfrom-kyowariasahikawafrom-lancashi" +
"recreationfrom-mamurogawafrom-mdfrom-meeresistancefrom-mifunefro" +
"m-mnfrom-modalenfrom-mscotlandfrom-mtnfrom-nchocolatelemarkasaok" +
"amiminersamsclubartowhoswhokksundyndns-ipartsamsungrimstadyndns-" +
"mailouvrehabmerfrom-ndfrom-nefrom-nh-serveblogsiteleafamilycompa" +
"nyminamiminowafrom-njaworznotogawafrom-nminamiogunicomcastresind" +
"evicescrapper-sitefrom-nv-infoodnetworkshoppingxn--12co0c3b4eval" +
"leaostaticscrappingfrom-nyfrom-ohtawaramotoineppuboliviajessheim" +
"periafrom-oketohmangolffanscrysechofunatoriginstitutelevisionish" +
"itosashimizunaminamibosogndalowiczest-le-patronishiwakis-a-cater" +
"erfrom-orfrom-padovaksdalfrom-pratohnoshooguyfrom-ris-a-geekaufe" +
"nfrom-schmidtre-gauldalfrom-sdfrom-tnfrom-txn--1ck2e1barrel-of-k" +
"nowledgeologyombolzano-altoadigeverbankarasjohkamikoaniikappuebl" +
"ockbustermezgorzeleccoffeedbackplaneapplefrakkestadisrechtrainin" +
"gjerstadotsuruokakegawauthordalandeportenrightathomeftpalmaserat" +
"ibmdevelopmentateshinanomachimkentateyamaustevoll-o-g-i-navigati" +
"onavoi234lima-cityeatselinogradultatarantoyakokonoe12hpalermomah" +
"achijolstereviewskrakowebspace164-bananarepublic66from-utazueric" +
"hardlillehammerfeste-ipatriafrom-val-daostavalleyfrom-vtrentin-s" +
"uedtirolfrom-wafrom-wielunnerfrom-wvalled-aostavangerfrom-wyfros" +
"inonefrostalowa-wolawafroyahikobeardubaiduckdnserveminecraftrent" +
"ino-a-adigefstcgroupaviancarrierfujiiderafujikawaguchikonefujimi" +
"nokamoenairlinemurorangemologicallcube-serversaillest-mon-blogue" +
"urovisionthewifiat-band-campaniafujinomiyadavvenjargaulardalfuji" +
"okayamangyshlakasamatsudoomdnsiskinkyotobetsulikes-piedmonticell" +
"odingenfujisatoshonairportland-4-salernoboribetsuckservemp3fujis" +
"awafujishiroishidakabiratoridefensells-for-lesservep2pfizerfujit" +
"surugashimaniwakuratexasiafujixeroxn--1ctwolominamatakkokaminoya" +
"maxunusualpersonfujiyoshidavvesiidattorelayfukayabeatservepicser" +
"vequakefukuchiyamadazaifudaigodonnakaniikawatanagurafukudominich" +
"onanbuildingripefukuis-a-greenfukumitsubishigakisarazurecontaine" +
"rdpolicefukuokazakishiwadafukuroishikarikaturindalfukusakisofuku" +
"shimannore-og-uvdalfukuyamagatakaharunzenfunabashiriuchinadafuna" +
"gatakahashimamakisosakitagawafunahashikamiamakusatsumasendaisenn" +
"angonohejis-a-guruslivinghistoryfundaciofuoiskujukuriyamansionse" +
"rvesarcasmatartanddesignfuosskoczowindmillfurnituredumbrellancas" +
"terfurubirafurudonostiaafurukawairtelebitballooningfusodegaurafu" +
"ssaikitahatakahatakaishimogosenfutabayamaguchinomigawafutboldlyg" +
"oingnowhere-for-morenakatsugawafuttsurugiminamisanrikubetsurfast" +
"ly-terrariuminamiiselectransurlvivanovodkamisatokamachintaifun-d" +
"nsaliaskvollfuturecmservicesevastopolefuturehostingfuturemailing" +
"fvgfylkesbiblackbaudcdn77-securebungoonord-frontierfyresdalhands" +
"onhangglidinghangoutsystemscloudnsewindowsharis-a-knightpointtok" +
"aizukameokameyamatotakadahannanmokuizumodenakayamarburghannosega" +
"wahanyuzenhapmirhareidsbergenharstadharvestcelebrationhasamarche" +
"apigeelvinckazohasaminami-alpsharpharmacienshawaiijimarnardalhas" +
"hbanghasudahasura-appharmacyshellaspeziahasvikazunowruzhgorodeoh" +
"atogayaitakamoriokalmykiahatoyamazakitakatakanabeautysneshimojis" +
"-a-landscaperhatsukaichikaiseis-a-lawyerhattfjelldalhayashimamot" +
"obulsan-suedtirolhazuminobusellsyourhomegoodshimokawahelsinkitak" +
"yushuaiahembygdsforbundhemneshimokitayamahemsedalhepforgeherokus" +
"sldheroyhgtvalledaostavernhigashiagatsumagoianiahigashichichibun" +
"gotakadancehigashihiroshimanehigashiizumozakitamihamadahigashika" +
"gawahigashikagurasoedahigashikawakitaaikitamotosumy-gatewayhigas" +
"hikurumeethnologyhigashimatsushimaritimodernhigashimatsuyamakita" +
"akitadaitoigawahigashimurayamamotorcycleshimonitayanagithubuserc" +
"ontentrentino-aadigehigashinarusembokukitanakagusukumoduminamita" +
"nehigashinehigashiomihachimanaustdalhigashiosakasayamanakakogawa" +
"higashishirakawamatakanezawahigashisumiyoshikawaminamiaikitashio" +
"barahigashitsunoshiroomurahigashiurausukitaurayasudahigashiyamat" +
"okoriyamanashifteditchyouriphdhigashiyodogawahigashiyoshinogaris" +
"-a-liberalhiraizumisatohobby-sitehirakatashinagawahiranairtraffi" +
"cplexus-1hirarahiratsukagawahirayaizuwakamatsubushikusakadogawah" +
"istorichouseshimonosekikawahitachiomiyagildeskaliszhitachiotagoo" +
"glecodespotaruis-a-libertarianhitraeumtgeradelmenhorstalbanshimo" +
"suwalkis-a-linux-useranishiaritabashijonawatehjartdalhjelmelandh" +
"oleckobierzyceholidayhomeiphiladelphiaareadmyblogspotrentino-alt" +
"o-adigehomelinkitoolsztynsettlershimotsukehomelinuxn--1lqs03nhom" +
"eofficehomesecuritymacaparecidahomesecuritypchoseiroumuencheniss" +
"andiegohomesenseminehomeunixn--1lqs71dhondahoneywellbeingzonehon" +
"gopocznorfolkebibleirfjordhonjyoitakaokaluganskypehornindalhorse" +
"oullensvanguardhorteneis-a-llamarriottrentino-altoadigehospitalh" +
"oteleshimotsumahotmailhoyangerhoylandetroitskddielddanuorrikuzen" +
"takatajimidoriopretogliattireshinichinanhumanitieshinjournalisma" +
"ilillesandefjordhurdalhurumajis-a-musicianhyllestadhyogoris-a-na" +
"scarfanhyugawarahyundaiwafuneis-very-niceis-very-sweetpepperis-w" +
"ith-thebandownloadisleofmanchesterjewelryjewishartgalleryjfkhark" +
"ivallee-aosteroyjgorajlljmphoenixn--1qqw23ajnjcphilipsynology-di" +
"skstationjoyentrentino-sudtiroljoyokaichibalatinogiftshintomikas" +
"aharajpnjprshinyoshitomiokamogawajurkoshunantankhersonkosugekoto" +
"hiradomainsureggiocalabriakotourakouhokutamakis-a-republicancerr" +
"esearchaeologicaliforniakounosupplieshirahamatonbetsurnadalkouya" +
"mashikekouzushimashikis-a-rockstarachowicekozagawakozakis-a-soci" +
"alistdlibestadkozowinnershirakoelnkpnkppspdnshiranukanagawakrasn" +
"ikahokutokigawakrasnodarkredstonekristiansandcatshiraois-a-soxfa" +
"nkristiansundkrodsheradkrokstadelvaldaostarnbergkryminamiuonumas" +
"sa-carrara-massacarraramassabunkyonanaoshimageandsoundandvisionk" +
"umatorinokumejimasoykumenantokonamegatakasugais-a-studentalkunis" +
"akis-a-teacherkassymantechnologykunitachiarailwaykunitomigusukum" +
"amotoyamashikokuchuokunneppugliakunstsammlungkunstunddesignkuokg" +
"rouphotographysiokureggioemiliaromagnamsskoganeis-a-techietis-a-" +
"nurservegame-serverkurgankurobelaudiblebesbyglandroverhalla-spez" +
"iakurogiminamiashigarakuroisoftwarendalenugkuromatsunais-a-thera" +
"pistoiakurotakikawasakis-an-accountantshinjukumanokushirogawakus" +
"tanais-an-actorkusupplykutchanelkutnokuzumakis-an-actresshinkami" +
"gotoyohashimotottoris-a-painteractivegaskimitsubatamibudejjuedis" +
"chesapeakebayernrtrentino-s-tirolkvafjordkvalsundkvamlidlugoleka" +
"fjordkvanangenkvinesdalkvinnheradkviteseidskogkvitsoykwpspectrum" +
"inamiyamashirokawanabelembetsukubankhmelnitskiyamarylandkzmitour" +
"ismolancomelbournemitoyoakemiuramiyazurewebsiteshikagamiishibuka" +
"wamiyotamanomjondalenmlbfanmonstermontrealestatefarmequipmentren" +
"tino-suedtirolmonza-brianzaporizhzhiamonza-e-della-brianzapposhi" +
"ratakahagitlabormonzabrianzaptokyotangotsukitahiroshimaoris-an-e" +
"ntertainermonzaebrianzaramonzaedellabrianzamoonscalevangermopara" +
"chutingmordoviamoriyamatsumotofukemoriyoshiminamiawajikis-bytoma" +
"ritimekeepingmormonmouthaebaruericssonyoursidell-ogliastradermor" +
"oyamatsunomortgagemoscowioshishikuis-certifieducatorahimeshimama" +
"teramobilymoseushistorymosjoenmoskeneshisognemosshisuifuelverumi" +
"nanomosviklabudhabikinokawabarthadselfipgfoggiamoteginowaniihama" +
"tamakawajimanxn--2scrj9christiansburgroks-thisayamanobeokakudama" +
"tsuemoviemovimientolgamovistargardmozilla-iotrentinoa-adigemtran" +
"bymuenstermuginozawaonsenmuikamisunagawamukodairamulhouservehalf" +
"lifestylewismillermunakatanemuncienciamuosattemupictetrentinoaad" +
"igemurmanskmpspbarrell-of-knowledgeometre-experts-comptables3-ex" +
"ternal-1murotorcraftrentinoalto-adigemusashimurayamatsusakahogin" +
"ankokubunjis-foundationmusashinoharamuseetrentinoaltoadigemuseum" +
"verenigingmusicargoboatshitaramamutsuzawamy-vigorgemy-wanggouvic" +
"enzamyactivedirectorymyasustor-elvdalmycdn77-sslattumincommbankh" +
"melnytskyivalleeaosteinkjerusalembroiderymydattolocalhistorymydd" +
"nskingmydissentrentinos-tirolmydobisshikis-gonemydroboehringerik" +
"emydshizukuishimofusaitamatsukuris-into-animeguroroshinshinotsur" +
"gerymyeffectrentinostirolmyfirewallonieruchomoscienceandindustry" +
"nmyfritzmyftpaccesshizuokanazawamyhome-servermyjinomykolaivanylv" +
"enicemymailermymediapchristmasakindlecznakaiwamizawatchandclocka" +
"shibatakasakiyosatokashikiyosemitemyokohamamatsudamypepicturesho" +
"ujis-into-carshinshiromypetshowamyphotoshibalestrandabergamoarek" +
"emypiagetmyiphostre-totendofinternet-dnshowtimemergencyahabahcav" +
"uotnagareyamaizuruhrmypsxn--30rr7ymysecuritycamerakermyshopblock" +
"shriramsterdamnserverbaniamytis-a-bookkeeperugiamytuleapiemontem" +
"yvnchromedicaltanissettairavennakamagayachtsandoymywireisenpiszp" +
"ittsburghofficialpiwatepixolinopizzapkolobrzegersundplanetariumi" +
"niserversicherungplantationplantsigdalplatformshangrilangevagrig" +
"entomologyeonggiehtavuoatnagaivuotnagaokakyotambabyendoftheinter" +
"netflixilovecollegefantasyleaguernseyplaystationplazaplchryslerp" +
"lumbingoplurinacionalpodhalezajskomaganepodlasiellaktyubinskiptv" +
"eterinairealmpmnpodzonepohlpoivronpokerpokrovskomakizunokunimima" +
"takashimarylhurstjordalshalsenpoliticartierpolitiendapolkowicepo" +
"ltavalle-aostarostwodzislawitdkomatsushimasfjordenpomorzeszowith" +
"googleapisa-hockeynutsiracusakataketomisatotalponpesaro-urbino-p" +
"esarourbinopesaromasvuotnaroypordenonepornporsangerporsangugepor" +
"sgrunnanyokoshibahikariwanumatakazakis-into-cartoonshintokushima" +
"poznanpraxis-a-bruinsfanprdpreservationpresidioprgmrprimelhusdec" +
"orativeartsilkomforbarsycentertainmentaxihuanhlfanhs3-fips-us-go" +
"v-west-1principeprivatizehealthinsuranceprochowiceproductionsimp" +
"le-urlprofesionalprogressivenneslaskerrylogisticsirdalpromombets" +
"urgeonshalloffameldalpropertyprotectionprotonetrentinosud-tirolp" +
"rudentialpruszkowithyoutuberspacekitagatakinoueprzeworskogptplus" +
"gardenpupilotsienarviikamitondabayashiogamagoriziapvhagakhanamig" +
"awapvtrentinosudtirolpwchungnamdalseidfjordyndns-remotewdyndns-s" +
"erverdalplfinancialpusercontentoyosatoyonakagyokutoyokawapzqldqp" +
"oniatowadaqslingquicksytestingquipelementsjcbnlqvchurcharternidy" +
"ndns-webhopencraftoyotapartystudynathomebuiltrentinsud-tirolstuf" +
"f-4-salestufftoread-booksnesokndalstuttgartrentinsudtirolsusakis" +
"-into-gamessinazawasusonosuzakaniepcesuzukanmakiwiensuzukis-leet" +
"nedalsvalbardunloppacificircleverappspotagersveiosvelvikomvuxn--" +
"2m4a15esvizzerasvn-reposolarssonswedenswidnicasacamdvrcampinagra" +
"ndebugattipsseljeepsongdalenviknaharimalatvuopmicrolightingswidn" +
"ikkofuefukihaboromskogswiebodzin-butterswiftcoverswinoujsciencea" +
"ndhistoryswissmarterthanyousynology-dsolognetrvaporcloudtrysilja" +
"ntulansolutionslupskommunalforbundtunesomatunkongsbergturystykan" +
"oyakumoldeloittemp-dnsomnarvikomonowtvalleedaostetuscanytushuiss" +
"ier-justicetuvalle-daostatic-accessootuxfamilytwmailvaroyvestfol" +
"dvestnesopotrentinosued-tirolvestre-slidrepaircraftingvollombard" +
"ynamic-dnsor-odalvestre-totennishiawakuravestvagoyvevelstadvibo-" +
"valentiavibovalentiavideovillasnesoddenmarkhangelskjakdnepropetr" +
"ovskiervaapsteiermarkongsvingervinnicasadelamonedapliernewspaper" +
"vinnytsiavirginiavirtual-userveexchangevirtualuserveftpinknx-ser" +
"verrankoshigayanagawavirtueeldomein-vigorlicevirtuelvisakegawavi" +
"terboknowsitallvivoldavixn--32vp30hagebostadvlaanderenvladikavka" +
"zimierz-dolnyvladimirvlogoipioneervminternationalfirearmshiraoka" +
"naniimihoboleslawiechoyodobashichikashukujitawaraumalopolskanlan" +
"dyndns-picsandnessjoenissayokkaichiropractichernovtsykkylvenetoe" +
"iheijinvestmentsamegawavolkswagentsor-varangervologdanskoninjamb" +
"ylvolvolkenkundenvolyngdalvossevangenvotevotingvotoyonowmflabsor" +
"foldworldworse-thandawowiwatsukiyonoticiaskoyabearalvahkihokumak" +
"ogenglandwpcomstagingwpdevcloudwritesthisblogsytewroclawloclawek" +
"onskowolayangrouphonefosshiojirishirifujiedawtcmisakis-an-artist" +
"gorywtfastpanelblagrarchaeologyeongbuklugsmileangaviikadenagaham" +
"aroyerwuozuwzmiuwajimaxn--3pxu8konsulatrobeepilepsydneyxn--42c2d" +
"9axn--45br5cylxn--45brj9cistrondheimmobilienissedalubindalublind" +
"esnesandvikcoromantovalle-d-aostathellexn--45q11citadeliveryggee" +
"xn--4gbriminingxn--4it168dxn--4it797konyvelombardiamondshioyanai" +
"zutwentexn--4pvxs4allxn--54b7fta0ccitichirurgiens-dentistes-en-f" +
"rancexn--55qw42gxn--55qx5dxn--5js045dxn--5rtp49civilaviationissh" +
"ingucciprianiigataishinomakinkobayashikaoirmitakeharaxn--5rtq34k" +
"ooris-a-personaltrainerxn--5su34j936bgsgxn--5tzm5gxn--6btw5axn--" +
"6frz82gxn--6orx2rxn--6qq986b3xlxn--7t0a264civilisationiyodogawax" +
"n--80adxhksorocabalsan-suedtirolkuszczytnoipirangap-northeast-3x" +
"n--80ao21axn--80aqecdr1axn--80asehdbashkiriautoscanadaeguambulan" +
"cempresashibetsukuiitatebayashiibajddarchitecturealtorlandgcagli" +
"aribeiraokinawashirosatochigiessensiositelekommunikationayorovno" +
"ceanographiquemrevistanbulsan-sudtirolavagiskeu-1xn--80aswgxn--8" +
"0augustownproviderxn--8ltr62kopervikharkovallee-d-aosteigenxn--8" +
"pvr4uxn--8y0a063axn--90a3academiamicaaarborteaches-yogasawaracin" +
"gxn--90aeroportalabamagasakishimabaraogakibichuoxn--90aishobarak" +
"awagoexn--90azhytomyravendbasilicataniaveroykeniwaizumiotsukumiy" +
"amazonawsadoes-itvedestrandiscountyokozeu-2xn--9dbhblg6dietcimdb" +
"asketballyngenvironmentalconservationikonanporomutashinaiiyamano" +
"uchikuhokuryugasakitcheninohekinannestadivttasvuotnakanotoddenin" +
"omiyakonojorpelandiyomitanoppdalavangenirasakin-the-bandain-vpnc" +
"asinorddalazioxn--9dbq2axn--9et52uxn--9krt00axn--andy-iraxn--aro" +
"port-byandexn--3bst00misasaguris-an-engineeringxn--asky-iraxn--a" +
"urskog-hland-jnbatochiokinoshimakeupowiathletajimabaridagawakuya" +
"bukijobserveronagarahkkeravjuegoshikikonaikawachinaganoharamcoac" +
"hampionshiphoptobamadridvagsoygardenebakkeshibechambagriculturen" +
"nebudapest-a-la-masionionjukudoyamagazinebraskaunjargalsacebetsu" +
"ikidsmynasushiobarackmazerbaijan-mayengerdalaheadjudaicable-mode" +
"mocraciavocatanzaroweddingjerdrumetacentrumeteorappalmspringsake" +
"rhcloudyclusterxn--avery-yuasakuhokkaidovre-eikerxn--b-5gaxn--b4" +
"w605ferdxn--balsan-sdtirol-nsbsorreisahayakawakamiichikawamisato" +
"urslzxn--bck1b9a5dre4civilizationxn--bdddj-mrabdxn--bearalvhki-y" +
"4axn--berlevg-jxaxn--bhcavuotna-s4axn--bhccavuotna-k7axn--bidr-5" +
"nachikatsuuraxn--bievt-0qa2xn--bjarky-fyaotsurreyxn--bjddar-ptam" +
"ayufuettertdasnetzxn--blt-elabourxn--bmlo-graingerxn--bod-2nativ" +
"eamericanantiquesortlandxn--bozen-sdtirol-2obanazawaxn--brnny-wu" +
"academy-firewall-gatewayxn--brnnysund-m8accident-investigation-a" +
"ptibleadpagespeedmobilizerochesterimo-i-ranaamesjevuemielno-ipif" +
"onycivilwarmanagementoyotomiyazakis-a-celticsfanxn--brum-voagatr" +
"entoyonezawaxn--btsfjord-9zaxn--bulsan-sdtirol-nsbatsfjordnpanam" +
"atsuzakincheonishiazaindianapolis-a-bloggerxn--c1avgxn--c2br7gxn" +
"--c3s14misawaxn--cck2b3bauhausposts-and-telecommunicationsncfdra" +
"ngedalillyonagoyavoues3-eu-west-1xn--cesena-forl-mcbremangerxn--" +
"cesenaforl-i8axn--cg4bkis-lostrodawaraxn--ciqpnxn--clchc0ea0b2g2" +
"a9gcdxn--comunicaes-v6a2oxn--correios-e-telecomunicaes-ghc29axn-" +
"-czr694bbvacationswatch-and-clockerxn--czrs0trevisohughesolundbe" +
"ckommunexn--czru2dxn--czrw28beneventodayonaguniversityoriikarasj" +
"okarasuyamarshallstatebankaratevje-og-hornnes3-sa-east-1xn--d1ac" +
"j3bentleyoshiokaracoldwarmiastagexn--d1alfaromeoxn--d1atritonxn-" +
"-d5qv7z876claimsanfranciscofreakuneuesuranceoxn--davvenjrga-y4ax" +
"n--djrs72d6uyxn--djty4koryokamikawanehonbetsurutaharaxn--dnna-gr" +
"ajewolterskluwerxn--drbak-wuaxn--dyry-iraxn--e1a4clanbibaidarmen" +
"iaxn--eckvdtc9dxn--efvn9soruminnesotaketakatoris-an-anarchistori" +
"calsocietyxn--efvy88haibarakitakamiizumisanofidelityxn--ehqz56nx" +
"n--elqq16hair-surveillancexn--estv75gxn--eveni-0qa01gaxn--f6qx53" +
"axn--fct429kosaigawaxn--fhbeiarnxn--finny-yuaxn--fiq228c5hsoundc" +
"astronomy-routerxn--fiq64beppublishproxyzjampagefrontappanasonic" +
"ateringebuilderschlesisches3-us-east-2xn--fiqs8southcarolinatalx" +
"n--fiqz9southwestfalenxn--fjord-lraxn--fjq720axn--fl-ziaxn--flor" +
"-jraxn--flw351exn--forl-cesena-fcbsowaxn--forlcesena-c8axn--fpcr" +
"j9c3dxn--frde-grandrapidspeedpartnersnoasaitoshimayfirstockholme" +
"strandxn--frna-woaraisaijosoyrovigotembaixadaxn--frya-hraxn--fzc" +
"2c9e2cldmailucaniaxn--fzys8d69uvgmailxn--g2xx48clickashiharaxn--" +
"gckr3f0fastvps-serverisignxn--gecrj9clinichiryukyuragifuchungbuk" +
"haranzanquanpachigasakievennodesaarlandyndns-blogdnsamnangerxn--" +
"ggaviika-8ya47hakatanortonxn--gildeskl-g0axn--givuotna-8yasakaim" +
"inatoyookannamilanotteroyxn--gjvik-wuaxn--gk3at1exn--gls-elacaix" +
"axn--gmq050is-not-certifiedunetbankfhappousrlxn--gmqw5axn--h-2fa" +
"ilxn--h1aeghakodatexn--h2breg3evenespjelkavikomorotsukamiokamiki" +
"tayamatsuris-a-patsfanxn--h2brj9c8cliniquenoharaxn--h3cuzk1digit" +
"alxn--hbmer-xqaxn--hcesuolo-7ya35beskidyn-ip24xn--hery-iraxn--hg" +
"ebostad-g3axn--hmmrfeasta-s4accident-prevention-webhostingxn--hn" +
"efoss-q1axn--hobl-iraxn--holtlen-hxaxn--hpmir-xqaxn--hxt814exn--" +
"hyanger-q1axn--hylandet-54axn--i1b6b1a6a2exn--imr513nxn--indery-" +
"fyasugivingxn--io0a7is-savedxn--j1aefauskedsmokorsetagayasells-f" +
"or-ulminamiizukamishihoronobeauxartsandcraftsarufutsunomiyawakas" +
"aikaitakoebenhavnxn--j1amhakonexn--j6w193gxn--jlq61u9w7bestbuysh" +
"ouses3-us-gov-west-1xn--jlster-byasuokanraxn--jrpeland-54axn--jv" +
"r189misconfusedxn--k7yn95exn--karmy-yuaxn--kbrq7oxn--kcrx77d1x4a" +
"xn--kfjord-iuaxn--klbu-woaxn--klt787dxn--kltp7dxn--kltx9axn--klt" +
"y5xn--3ds443gxn--koluokta-7ya57hakubahccavuotnagasakikuchikuseik" +
"arugamvikautokeinow-dnsevenassisicilyxn--kprw13dxn--kpry57dxn--k" +
"pu716fbsbxn--12cfi8ixb8lxn--kput3is-slickhakassiaxn--krager-gyat" +
"omitamamuraxn--kranghke-b0axn--krdsherad-m8axn--krehamn-dxaxn--k" +
"rjohka-hwab49jdfastlylbarefootballfinanzgoraustraliaisondriobran" +
"conagawalesundds3-ca-central-1xn--ksnes-uuaxn--kvfjord-nxaxn--kv" +
"itsy-fyatsukanumazuryxn--kvnangen-k0axn--l-1fairwindspreadbettin" +
"gxn--l1accentureklamborghinikolaeventspydebergxn--laheadju-7yats" +
"ushiroxn--langevg-jxaxn--lcvr32dxn--ldingen-q1axn--leagaviika-52" +
"betainaboxfusejnynysagaeroclubmedecincinnationwidealerxn--lesund" +
"-huaxn--lgbbat1ad8jelenia-goraxn--lgrd-poacctroandinosaureitrent" +
"insued-tirolxn--lhppi-xqaxn--linds-pramericanartrogstadxn--lns-q" +
"lanxessrtrentinosuedtirolxn--loabt-0qaxn--lrdal-sraxn--lrenskog-" +
"54axn--lt-liaclintonoshoesangoxn--lten-granexn--lury-iraxn--m3ch" +
"0j3axn--mely-iraxn--merker-kuaxn--mgb2ddesrvaoxn--mgb9awbfbx-osa" +
"sayamaxn--mgba3a3ejtromsakakinokiaxn--mgba3a4f16axn--mgba3a4fran" +
"amizuholdingstoregontrailroadxn--mgba7c0bbn0axn--mgbaakc7dvfbxos" +
"asebofagexn--mgbaam7a8hakuis-a-hard-workerxn--mgbab2bdxn--mgbai9" +
"a5eva00bhzcatholicaxiasdaburxn--mgbai9azgqp6jeonnamerikawauexn--" +
"mgbayh7gpaleoxn--mgbb9fbpobihirosakikamijimatsuuraxn--mgbbh1a71e" +
"xn--mgbc0a9azcgxn--mgbca7dzdoxn--mgberp4a5d4a87gxn--mgberp4a5d4a" +
"rxn--mgbgu82axn--mgbi4ecexposedxn--mgbpl2fhskydivingxn--mgbqly7c" +
"0a67fbclothingdustkagoshimalselvendrelluccapitalonewportlligatoy" +
"otsukaidoxn--mgbqly7cvafranziskanerimaringatlantakahamalvikosaka" +
"erodromegallupinbarsyonlinewhollandivtasvuodnakanojohanamakinoha" +
"rautomotiveconomiasakuchinotsuchiurakawalmartatsunoceanographics" +
"3-eu-central-1xn--mgbt3dhdxn--mgbtf8flatangerxn--mgbtx2bieidsvol" +
"limanowarudaxaustinnavuotnarashinobninskaragandaukraanghkeymachi" +
"newhampshirealtychyattorneyagawalbrzycharitydalces3-ap-southeast" +
"-1kappchizip6xn--mgbx4cd0abbvieeexn--mix082fedorapeoplegnicahces" +
"uoloansaskatchewanxn--mix891fedoraprojectrapaniizaxn--mjndalen-6" +
"4axn--mk0axin-dslgbtromsojamisonxn--mk1bu44cn-northwest-1xn--mkr" +
"u45is-uberleetrentino-stirolxn--mlatvuopmi-s4axn--mli-tlapyxn--m" +
"lselv-iuaxn--moreke-juaxn--mori-qsakuragawaxn--mosjen-eyawaraxn-" +
"-mot-tlaquilanciaxn--mre-og-romsdal-qqbielawalterxn--msy-ula0hak" +
"usanagochijiwadellogliastradingxn--mtta-vrjjat-k7aflakstadaokaga" +
"kicks-assedicngrondarxn--muost-0qaxn--mxtq1mishimasudaxn--ngbc5a" +
"zdxn--ngbe9e0axn--ngbrxn--3e0b707exn--nit225koseis-a-photographe" +
"rokuapphilatelyxn--nmesjevuemie-tcbalsfjordxn--nnx388axn--nodess" +
"akurais-very-badajozxn--nqv7fs00emaxn--nry-yla5gxn--ntso0iqx3axn" +
"--ntsq17gxn--nttery-byaeservehumourxn--nvuotna-hwaxn--nyqy26axn-" +
"-o1achaseljordxn--o3cw4haldenxn--o3cyx2axn--od0algxn--od0aq3biel" +
"laakesvuemieleccexn--ogbpf8flekkefjordxn--oppegrd-ixaxn--ostery-" +
"fyawatahamaxn--osyro-wuaxn--otu796dxn--p1acfeiraquarelleasingles" +
"assaris-a-designerxn--p1ais-very-evillagexn--pbt977cnpyatigorsko" +
"djeffersonxn--pgbs0dhlxn--porsgu-sta26fermochizukirovogradoyxn--" +
"pssu33lxn--pssy2uxn--q9jyb4cnsanjotoyouraxn--qcka1pmckinseyxn--q" +
"qqt11missilelxn--qxamusementdllxn--rady-iraxn--rdal-poaxn--rde-u" +
"larvikosherbrookegawaxn--rdy-0nabaris-very-goodyearxn--rennesy-v" +
"1axn--rhkkervju-01aferraraxn--rholt-mragowoodsidemoneyxn--rhqv96" +
"gxn--rht27zxn--rht3dxn--rht61exn--risa-5naturalhistorymuseumcent" +
"erxn--risr-iraxn--rland-uuaxn--rlingen-mxaxn--rmskog-byaxn--rny3" +
"1halsaintlouis-a-anarchistoireggio-calabriaxn--rovu88bieszczadyg" +
"eyachimataikikugawarszawashingtondclkaratsuginamikatagamilitaryu" +
"kindianmarketingjesdalimitedray-dnstracexn--rros-granvindafjordx" +
"n--rskog-uuaxn--rst-0naturalsciencesnaturellestorfjordxn--rsta-f" +
"rancaiseharaxn--rvc1e0am3exn--ryken-vuaxn--ryrvik-byaxn--s-1fait" +
"hruherecipescaravantaarpippulawyxn--s9brj9cntoystre-slidrettozaw" +
"axn--sandnessjen-ogbievatmallorcadaques3-us-west-1xn--sandy-yuax" +
"n--sdtirol-n2axn--seral-lraxn--ses554gxn--sgne-gratangenxn--skie" +
"rv-utazassnasabaerobaticketstorjdevcloudfrontdoorxn--skjervy-v1a" +
"xn--skjk-soaxn--sknit-yqaxn--sknland-fxaxn--slat-5naturbruksgymn" +
"xn--slt-elabcgxn--smla-hraxn--smna-gratis-a-bulls-fanxn--snase-n" +
"raxn--sndre-land-0cbifukagawashtenawdev-myqnapcloudappscbgjovika" +
"reliancexn--snes-poaxn--snsa-roaxn--sr-aurdal-l8axn--sr-fron-q1a" +
"xn--sr-odal-q1axn--sr-varanger-ggbihorologyukuhashimoichinosekig" +
"aharaxn--srfold-byaxn--srreisa-q1axn--srum-grazxn--stfold-9xaxn-" +
"-stjrdal-s1axn--stjrdalshalsen-sqbikedaejeonbukariyaltakasagotpa" +
"ntheonsitextileirvikarlsoyurihonjournalistjohnishigovtcp4xn--str" +
"e-toten-zcbilbaogashimadachicago-vipsinaapparaglidingladefinimak" +
"anegasakiraxn--t60b56axn--tckweatherchannelxn--tiq49xqyjetztrent" +
"ino-sud-tirolxn--tjme-hraxn--tn0agrinet-freakstpetersburgxn--tns" +
"berg-q1axn--tor131oxn--trany-yuaxn--trentin-sd-tirol-rzbillustra" +
"tionishiharaxn--trentin-sdtirol-7vbioxn--trentino-sd-tirol-c3bir" +
"dartcenterprisesakimobetsuitainaioirasebastopologyeongnamegawaka" +
"yamagentositecnologiaxn--trentino-sdtirol-szbirkenesoddtangenova" +
"raholtalenishiizunazukindigenaklodzkochikushinonsenergyusuharaxn" +
"--trentinosd-tirol-rzbirthplacexn--trentinosdtirol-7vbjarkoyusui" +
"sserveirchattanooganordkapparisor-fronishikatakatsukindustriaxn-" +
"-trentinsd-tirol-6vbjerkreimbarcelonagasukeu-3utilitiesquare7xn-" +
"-trentinsdtirol-nsbjugnieznord-aurdalpha-myqnapcloud66xn--trgsta" +
"d-r1axn--trna-woaxn--troms-zuaxn--tysvr-vraxn--uc0atvareservehtt" +
"pimientakayamattelefonicarbonia-iglesias-carboniaiglesiascarboni" +
"axn--uc0ay4axn--uist22hammarfeastafricapetownnews-stagingxn--uis" +
"z3gxn--unjrga-rtaobaomoriguchiharagusartstreamuneustarhubssokane" +
"yamazoexn--unup4yxn--uuwu58axn--vads-jraxn--valle-aoste-ebbcn-no" +
"rth-1xn--valle-d-aoste-ehbodoesntexisteingeekoshimizumakis-a-pla" +
"yerxn--valleaoste-e7axn--valledaoste-ebbtrusteexn--vard-jraxn--v" +
"egrshei-c0axn--vermgensberater-ctblackfridayuu2-localhostrowwlkp" +
"mglassassinationalheritagexn--vermgensberatung-pwbloombergbauern" +
"uorockartuzyuzawaxn--vestvgy-ixa6oxn--vg-yiabkhaziaxn--vgan-qoax" +
"n--vgsy-qoa0jevnakershuscultureggio-emilia-romagnamsosnowiechosh" +
"ibuyachiyodatsunanjoburgriwataraidyndns-office-on-the-weberxn--v" +
"gu402coguchikuzenxn--vhquvarggatrentinsuedtirolxn--vler-qoaxn--v" +
"re-eiker-k8axn--vrggt-xqadxn--vry-yla5gxn--vuq861bloxcms3-us-wes" +
"t-2xn--w4r85el8fhu5dnraxn--w4rs40lxn--wcvs22dxn--wgbh1collection" +
"xn--wgbl6axn--xhq521bluedagestangeorgeorgiaxn--xkc2al3hye2axn--x" +
"kc2dl3a5ee0hamurakamigoris-a-hunterxn--y9a3aquariumisugitokuyama" +
"tsumaebashikshacknetrentino-sued-tirolxn--yer-znaturhistorisches" +
"tudioxn--yfro4i67oxn--ygarden-p1axn--ygbi2ammxn--3hcrj9circustom" +
"erxn--ystre-slidre-ujbmoattachments3-website-ap-northeast-1xn--z" +
"bx025dxn--zf0ao64axn--zf0avxn--3oq18vl8pn36axn--zfr164bms3-websi" +
"te-ap-southeast-1xnbayxz"
// nodes is the list of nodes. Each node is represented as a uint32, which
// encodes the node's children, wildcard bit and node type (as an index into
// the children array), ICANN bit and text.
//
// If the table was generated with the -comments flag, there is a //-comment
// after each node's data. In it is the nodes-array indexes of the children,
// formatted as (n0x1234-n0x1256), with * denoting the wildcard bit. The
// nodeType is printed as + for normal, ! for exception, and o for parent-only
// nodes that have children but don't match a domain label in their own right.
// An I denotes an ICANN domain.
//
// The layout within the uint32, from MSB to LSB, is:
// [ 0 bits] unused
// [10 bits] children index
// [ 1 bits] ICANN bit
// [15 bits] text index
// [ 6 bits] text length
var nodes = [...]uint32{
0x331903,
0x3ac504,
0x2dc686,
0x257e03,
0x257e06,
0x390646,
0x3b1283,
0x2e1dc4,
0x200947,
0x2dc2c8,
0x1a00742,
0x1f47007,
0x37a1c9,
0x2cd70a,
0x2cd70b,
0x22c4c3,
0x2cf7c6,
0x234085,
0x2200a42,
0x3b8584,
0x260503,
0x280745,
0x2609682,
0x32cd43,
0x2b321c4,
0x209685,
0x2e00102,
0x274d0e,
0x253f83,
0x3c6846,
0x3204e82,
0x303d47,
0x236e06,
0x360b9c2,
0x28d683,
0x28d684,
0x20b9c6,
0x22b1c8,
0x2947c6,
0x314d04,
0x3a00602,
0x3539c9,
0x225847,
0x208646,
0x3777c9,
0x352388,
0x335184,
0x33dd46,
0x23c906,
0x3e00582,
0x25d34f,
0x20e18e,
0x221944,
0x219505,
0x331805,
0x2f0149,
0x240589,
0x20c1c7,
0x363186,
0x207443,
0x4206fc2,
0x2240c3,
0x24e84a,
0x4603643,
0x27d905,
0x306242,
0x39ebc9,
0x4e00282,
0x22a184,
0x33be06,
0x32d945,
0x3717c4,
0x5612cc4,
0x229a43,
0x232e04,
0x5a04442,
0x385544,
0x5e8b584,
0x2056ca,
0x6201782,
0x33a9c7,
0x38f4c8,
0x7203782,
0x26cb87,
0x22c844,
0x2cb807,
0x22c845,
0x34c6c7,
0x27e586,
0x32cac4,
0x32cac5,
0x285507,
0x8207682,
0x334183,
0x21aa02,
0x38e2c3,
0x8613b82,
0x21ad85,
0x8a03c82,
0x2f4bc4,
0x284945,
0x221887,
0x28188e,
0x2874c4,
0x2348c4,
0x226c43,
0x3c2709,
0x226c4b,
0x24a1c8,
0x377588,
0x258f08,
0x2183c8,
0x334fca,
0x34c5c7,
0x2d0286,
0x8e4ee42,
0x3c8e43,
0x3ca983,
0x3501c4,
0x3b12c3,
0x3c8e83,
0x1742942,
0x9200f02,
0x28cc45,
0x29fbc6,
0x24bf44,
0x353087,
0x239d86,
0x2c3204,
0x36fdc7,
0x200f03,
0x96d45c2,
0x9b29902,
0x9e299c2,
0x2299c6,
0xa200882,
0x2b6385,
0x343e83,
0x3b6844,
0x2f60c4,
0x2f60c5,
0x3bc883,
0xa64dd03,
0xab447c2,
0x2992c5,
0x3cb84b,
0x27cf8b,
0x274a84,
0x3ccc49,
0x3d3504,
0xae0a302,
0x3d8d83,
0x20a303,
0xb206ac2,
0x306b03,
0x20a58a,
0xb600302,
0x2e44c5,
0x2e7d0a,
0x3840c4,
0x20b183,
0x20cfc4,
0x2101c3,
0x2101c4,
0x2101c7,
0x210d05,
0x211dc6,
0x212086,
0x213603,
0x215a48,
0x20c643,
0xba004c2,
0x248688,
0x20eecb,
0x21d1c8,
0x21db86,
0x21eb07,
0x223408,
0xca064c2,
0xce1c002,
0x33d088,
0x30c0c7,
0x28e105,
0x35c208,
0xd227508,
0x36fec3,
0x228644,
0x350202,
0xd629c82,
0xda012c2,
0xe22a242,
0x22a243,
0xe605382,
0x32b383,
0x239444,
0x208e43,
0x286784,
0x208e4b,
0x205543,
0x2efb06,
0x205544,
0x2c0e4e,
0x24ad45,
0x3c6948,
0x389a47,
0x389a4a,
0x226e03,
0x3ac307,
0x226e05,
0x22fc84,
0x2574c6,
0x2574c7,
0x2ed284,
0x2f8907,
0x30bb04,
0x205384,
0x205386,
0x270ec4,
0x337fc6,
0x20e9c3,
0x35bfc8,
0x385288,
0x234883,
0x306ac3,
0x34dc84,
0x35e803,
0xea0ecc2,
0xee99502,
0x210483,
0x246bc6,
0x354a83,
0x230344,
0xf250202,
0x250203,
0x34cec3,
0x213fc2,
0xf600d82,
0x2ce686,
0x2353c7,
0x38f947,
0x39c105,
0x3c1204,
0x29cf45,
0x297d07,
0x2eb549,
0x2f10c6,
0x2f5dc8,
0x306c46,
0xfa01542,
0x328148,
0x30a606,
0x354585,
0x324c07,
0x326884,
0x326885,
0x280384,
0x280388,
0xfe14742,
0x10203f02,
0x354286,
0x203f08,
0x361bc5,
0x362906,
0x368888,
0x389188,
0x1060e585,
0x10a73304,
0x37c687,
0x10e98482,
0x11392ac2,
0x12604502,
0x33bf05,
0x2b00c5,
0x27d506,
0x2f5307,
0x22ab07,
0x12e2cc43,
0x275cc7,
0x2e5dc8,
0x1c62cc49,
0x274ec7,
0x22dc47,
0x22e508,
0x22ed06,
0x22f786,
0x23070c,
0x23148a,
0x231e07,
0x233f4b,
0x235207,
0x23520e,
0x1ca36184,
0x236384,
0x239307,
0x262087,
0x23f5c6,
0x23f5c7,
0x23fa07,
0x1ce33782,
0x240c86,
0x240c8a,
0x24148b,
0x2437c7,
0x244245,
0x245303,
0x245986,
0x245987,
0x22b6c3,
0x1d203b82,
0x24620a,
0x1d77b682,
0x1da4a0c2,
0x1de48382,
0x1e236f02,
0x249605,
0x249d84,
0x1ea01482,
0x3855c5,
0x233343,
0x2a4185,
0x2182c4,
0x20ce84,
0x237946,
0x3cf286,
0x2b2483,
0x3a8844,
0x378343,
0x1fa046c2,
0x21ee84,
0x37cc06,
0x21ee85,
0x2635c6,
0x324d08,
0x237b44,
0x310208,
0x22af85,
0x2491c8,
0x2c7d46,
0x326c87,
0x293484,
0x20e93486,
0x275fc3,
0x3a04c3,
0x325c08,
0x334dc4,
0x368ec7,
0x21202a46,
0x2e5309,
0x334688,
0x259588,
0x26d584,
0x337443,
0x233a42,
0x216979c2,
0x21a12b82,
0x34ae43,
0x21e00a82,
0x22b644,
0x24f606,
0x200a85,
0x242d83,
0x22cf84,
0x2c0107,
0x27e1c3,
0x2bc288,
0x20d085,
0x25ef83,
0x2848c5,
0x284a04,
0x30a306,
0x216344,
0x21df86,
0x2217c6,
0x33c5c4,
0x2355c3,
0x22212f02,
0x226346c5,
0x201903,
0x22e01502,
0x205b03,
0x217d45,
0x232ec3,
0x23232ec9,
0x236043c2,
0x23e03102,
0x298e05,
0x214646,
0x3bfc46,
0x339908,
0x33990b,
0x3bd14b,
0x30c445,
0x2d4d09,
0x1601702,
0x2d9788,
0x20f484,
0x24601d42,
0x3c2d43,
0x24e62246,
0x354908,
0x252003c2,
0x226548,
0x25610ac2,
0x286fca,
0x25adb343,
0x2637a806,
0x27c7c8,
0x3167c8,
0x2e1a86,
0x388607,
0x25d547,
0x23c48a,
0x384144,
0x366f84,
0x379b09,
0x267abf05,
0x20e386,
0x200143,
0x2785c4,
0x26a04b04,
0x204b07,
0x23a5c7,
0x296f04,
0x26a105,
0x27d5c8,
0x24a687,
0x24ab07,
0x26e1cd02,
0x287384,
0x358b08,
0x24b9c4,
0x24f1c4,
0x24f805,
0x24f947,
0x27250989,
0x250484,
0x251109,
0x251348,
0x251f04,
0x251f07,
0x27652683,
0x252807,
0x160d342,
0x16bce82,
0x253986,
0x253fc7,
0x255144,
0x256ac7,
0x258107,
0x258843,
0x233bc2,
0x21f582,
0x276703,
0x276704,
0x27670b,
0x377688,
0x25e944,
0x25ab05,
0x25c6c7,
0x25df45,
0x2e334a,
0x25e883,
0x27a0c542,
0x20c544,
0x261e49,
0x266843,
0x266907,
0x3afa09,
0x299ac8,
0x238443,
0x28aec7,
0x28b689,
0x216fc3,
0x292804,
0x293a89,
0x295d86,
0x221b83,
0x200a02,
0x236a03,
0x2bcc87,
0x236a05,
0x38b206,
0x23e404,
0x309185,
0x32bc03,
0x213846,
0x201282,
0x24dcc4,
0x27e09542,
0x28363c03,
0x28600b42,
0x24d083,
0x212504,
0x212507,
0x3d3806,
0x204ac2,
0x28a04a82,
0x324f04,
0x28e47842,
0x29202382,
0x2bec44,
0x2bec45,
0x202385,
0x36d146,
0x2960a942,
0x3b8d05,
0x3cc045,
0x20a943,
0x212686,
0x212fc5,
0x229942,
0x361805,
0x229944,
0x237a83,
0x237cc3,
0x29a0ae82,
0x2332c7,
0x255444,
0x255449,
0x2784c4,
0x2998c3,
0x3a3ac8,
0x29eaff44,
0x2aff46,
0x2b6003,
0x25b343,
0x215e43,
0x2a2f3402,
0x3063c2,
0x2a6040c2,
0x345a88,
0x38ce08,
0x3b18c6,
0x28e645,
0x28e2c5,
0x206907,
0x229505,
0x24cc42,
0x2aaa3242,
0x2ae03ac2,
0x238888,
0x328085,
0x2fbe44,
0x263505,
0x24b547,
0x292384,
0x246102,
0x2b203142,
0x359244,
0x223d47,
0x29a347,
0x34c684,
0x3c9603,
0x2347c4,
0x2347c8,
0x22fac6,
0x25734a,
0x22f284,
0x2a1d48,
0x2961c4,
0x21ec06,
0x2a3204,
0x33c206,
0x255709,
0x237187,
0x226b03,
0x2b65fec2,
0x26d803,
0x2783c2,
0x2ba06d82,
0x2fa306,
0x383148,
0x2b2387,
0x228b89,
0x2a1909,
0x2b41c5,
0x2b51c9,
0x2b5985,
0x2b5ac9,
0x2b6ec5,
0x2b7dc8,
0x2be3d3c4,
0x2c258987,
0x22e003,
0x2b7fc7,
0x22e006,
0x2b83c7,
0x2af1c5,
0x2c2903,
0x2c631242,
0x20b3c4,
0x2ca540c2,
0x2ce58e82,
0x350cc6,
0x38f445,
0x2bb407,
0x27f003,
0x201c04,
0x20c9c3,
0x33cdc3,
0x2d205142,
0x2da01d02,
0x390744,
0x233b83,
0x248ec5,
0x2de0d282,
0x2e6082c2,
0x2daec6,
0x334f04,
0x323884,
0x32388a,
0x2ee01582,
0x26b0c3,
0x21920a,
0x21cc88,
0x2f21f504,
0x2019c3,
0x208f43,
0x278b09,
0x224d49,
0x2c0206,
0x2f613303,
0x213305,
0x31990d,
0x21ce46,
0x31c14b,
0x2fa00802,
0x32ba88,
0x3220bc02,
0x326008c2,
0x320745,
0x32a00bc2,
0x297447,
0x2b9f07,
0x213183,
0x32f488,
0x32e02282,
0x2aba04,
0x3343c3,
0x38c205,
0x241b86,
0x21d704,
0x306a83,
0x2bdb43,
0x33214bc2,
0x30c3c4,
0x3b9dc5,
0x2bc887,
0x287f83,
0x2bd543,
0x161a982,
0x2bd603,
0x2bdac3,
0x3360d382,
0x33b104,
0x3cf486,
0x3a1803,
0x2be243,
0x33a4e2c2,
0x24e2c8,
0x2bf204,
0x33b6c6,
0x260e07,
0x27aec6,
0x2b8b04,
0x41605e02,
0x22decb,
0x3008ce,
0x2151cf,
0x366883,
0x41e5f482,
0x1643dc2,
0x42207542,
0x29f583,
0x2562c3,
0x21a146,
0x2eb7c6,
0x336447,
0x309b84,
0x42614782,
0x42a0d582,
0x2c3745,
0x2f9787,
0x3a3146,
0x42e4a002,
0x3cbf84,
0x2c3883,
0x43253a82,
0x437767c3,
0x2c4604,
0x2c9ec9,
0x43ad1d42,
0x43e16d02,
0x2888c5,
0x442d2e02,
0x44600682,
0x365e87,
0x210609,
0x37a44b,
0x25d305,
0x293e89,
0x3952c6,
0x2d3107,
0x44a060c4,
0x2cbb49,
0x37f007,
0x2114c7,
0x226683,
0x2beac6,
0x322907,
0x246e43,
0x2a0886,
0x4520a842,
0x45633142,
0x216143,
0x211605,
0x227807,
0x27d9c6,
0x236985,
0x2514c4,
0x2ae085,
0x392404,
0x45a06742,
0x377c47,
0x2d0d44,
0x224c44,
0x224c4d,
0x2e0009,
0x30ccc8,
0x25c044,
0x34d145,
0x3a9547,
0x20f2c4,
0x26b087,
0x323f05,
0x45e16c44,
0x2bdc85,
0x207b44,
0x2924c6,
0x2f5105,
0x462213c2,
0x286803,
0x391084,
0x391085,
0x350746,
0x236ac5,
0x2383c4,
0x25cd03,
0x220446,
0x228205,
0x22a705,
0x2f5204,
0x2f3943,
0x3051cc,
0x466bc982,
0x46a1ef42,
0x46e08242,
0x223643,
0x223644,
0x4720d642,
0x350e88,
0x38b2c5,
0x23eec4,
0x2471c6,
0x47608ec2,
0x47a0e482,
0x47e000c2,
0x29e605,
0x33c486,
0x221504,
0x20bf06,
0x33a786,
0x230183,
0x483492ca,
0x278405,
0x24e803,
0x220246,
0x3a91c9,
0x220247,
0x2b7788,
0x352249,
0x27ee48,
0x3c5306,
0x2e5e83,
0x48675d42,
0x3a1cc8,
0x48a51402,
0x48e02bc2,
0x228c03,
0x2eb3c5,
0x2a6184,
0x2d3249,
0x2eeb44,
0x21c688,
0x2092c3,
0x496092c4,
0x214688,
0x224b87,
0x49a18ec2,
0x23d382,
0x331785,
0x267bc9,
0x20e403,
0x28de84,
0x3198c4,
0x213cc3,
0x28e88a,
0x49e7f742,
0x4a20b202,
0x2d4543,
0x393fc3,
0x1600082,
0x200083,
0x4a61c0c2,
0x4aa08302,
0x4ae1af04,
0x21af06,
0x2db106,
0x242384,
0x286103,
0x3b4cc3,
0x280ec3,
0x241806,
0x3a4c45,
0x2d46c7,
0x2d7e85,
0x2d9346,
0x2da288,
0x2da486,
0x269c04,
0x2a778b,
0x2de103,
0x2de105,
0x2de588,
0x2055c2,
0x366182,
0x4b249682,
0x4b602c42,
0x208583,
0x4ba728c2,
0x2728c3,
0x2deec3,
0x4c220982,
0x4c6e3e86,
0x25ddc6,
0x4cae3fc2,
0x4ce0a342,
0x4d237d02,
0x4d69f502,
0x4da1c8c2,
0x4de032c2,
0x21e6c3,
0x209745,
0x34d2c6,
0x4e221904,
0x37ca0a,
0x3a5a06,
0x256644,
0x206cc3,
0x4ee047c2,
0x2015c2,
0x222a03,
0x4f21c103,
0x366707,
0x2f5007,
0x50a76807,
0x3c7bc7,
0x2272c3,
0x38b64a,
0x315dc4,
0x22ac44,
0x22ac4a,
0x23aa45,
0x50e0e342,
0x256a83,
0x51201a02,
0x252043,
0x26d7c3,
0x51a01bc2,
0x275c44,
0x206b04,
0x335905,
0x31ce45,
0x2b4f06,
0x31b546,
0x51e4ffc2,
0x52202fc2,
0x382745,
0x25dad2,
0x364506,
0x275283,
0x29ec46,
0x310845,
0x160a5c2,
0x5a60ab02,
0x3709c3,
0x20ab03,
0x29aec3,
0x5aa09342,
0x23f543,
0x5ae07482,
0x200843,
0x33b148,
0x27d543,
0x2b4046,
0x32e207,
0x320186,
0x32018b,
0x256587,
0x312dc4,
0x5b606342,
0x38b145,
0x5ba0f0c3,
0x22c403,
0x33d505,
0x38b543,
0x5bf8b546,
0x2d990a,
0x242003,
0x20b8c4,
0x203e46,
0x286486,
0x5c201ac3,
0x201ac7,
0x278a07,
0x2a9ac5,
0x367c46,
0x228243,
0x5ee128c3,
0x5f208702,
0x22f344,
0x35bdc9,
0x3c1685,
0x229604,
0x35f748,
0x273a05,
0x5f7075c5,
0x245409,
0x208703,
0x24a044,
0x5fa036c2,
0x2149c3,
0x5fe8ad42,
0x28ad46,
0x162b802,
0x6029d842,
0x29e508,
0x2ac6c3,
0x2bdbc7,
0x320405,
0x2ca0c5,
0x2ca0cb,
0x2ed886,
0x2ca2c6,
0x2ee0c6,
0x28ce84,
0x2e0c06,
0x606ecd88,
0x251883,
0x256103,
0x276ac4,
0x316d84,
0x3196c7,
0x2f27c5,
0x60af2902,
0x60e0a482,
0x61617c45,
0x2f5944,
0x2f594b,
0x2f5fc8,
0x259c44,
0x61a4e302,
0x61e24a42,
0x337f43,
0x2f75c4,
0x2f7885,
0x2f8ac7,
0x2fb984,
0x34c784,
0x62213282,
0x37e8c9,
0x2fd185,
0x25d5c5,
0x2fdd05,
0x62614903,
0x2ffc84,
0x2ffc8b,
0x300184,
0x30044b,
0x300d85,
0x21530a,
0x301548,
0x30174a,
0x301fc3,
0x301fca,
0x62e4ef82,
0x632031c2,
0x63600e83,
0x63b04542,
0x304543,
0x63f7a982,
0x64344602,
0x305f84,
0x215b86,
0x20bc45,
0x306bc3,
0x331ec6,
0x20b745,
0x3cf784,
0x64600382,
0x22b484,
0x2d498a,
0x32dbc7,
0x38f286,
0x3ac147,
0x2029c3,
0x2c4648,
0x293c4b,
0x2741c5,
0x2f1d45,
0x2f1d46,
0x37de04,
0x3b3008,
0x220b83,
0x23c804,
0x23c807,
0x312a06,
0x26fa46,
0x2c0c8a,
0x244f44,
0x244f4a,
0x64a81286,
0x281287,
0x25ab87,
0x281f44,
0x281f49,
0x237805,
0x27ea4b,
0x2f3cc3,
0x21e143,
0x64e1a683,
0x328a84,
0x65204102,
0x225286,
0x656c2685,
0x29ee85,
0x21e3c6,
0x2ab4c4,
0x65a04c42,
0x245344,
0x65e01202,
0x201205,
0x2ef404,
0x66a20f83,
0x66e03402,
0x203403,
0x362b06,
0x67208a82,
0x3637c8,
0x2200c4,
0x2200c6,
0x394846,
0x25c784,
0x2203c5,
0x273208,
0x273b07,
0x324107,
0x32410f,
0x358a06,
0x2412c3,
0x24c244,
0x20c783,
0x21ed44,
0x258284,
0x67604982,
0x299203,
0x341703,
0x67a03582,
0x20edc3,
0x3b2d83,
0x210d8a,
0x27b187,
0x25e20c,
0x25e4c6,
0x25f046,
0x260b07,
0x67e2e947,
0x270549,
0x2487c4,
0x272584,
0x682085c2,
0x68600c02,
0x2c1046,
0x2018c4,
0x299686,
0x22edc8,
0x2116c4,
0x297486,
0x3bfc05,
0x298508,
0x23fb03,
0x374585,
0x29a843,
0x25d6c3,
0x25d6c4,
0x20c503,
0x68a4e702,
0x68e062c2,
0x2f3b89,
0x29d745,
0x29dac4,
0x29e705,
0x23ea44,
0x3d5207,
0x380545,
0x692769c4,
0x2769c8,
0x2ecf46,
0x2ed6c4,
0x2ee9c8,
0x2f0007,
0x6960fd02,
0x2fe284,
0x3092c4,
0x39ee47,
0x69a0fd04,
0x257d82,
0x69e11202,
0x21b7c3,
0x2887c4,
0x2b6b43,
0x2b6b45,
0x6a207b02,
0x3062c5,
0x293202,
0x30e345,
0x321a45,
0x6a60d202,
0x34ce44,
0x6aa04f42,
0x260586,
0x2c2f06,
0x267d08,
0x2cc6c8,
0x350c44,
0x30b5c5,
0x30f189,
0x30c4c4,
0x2d98c4,
0x26dfc3,
0x6ae3c5c5,
0x249485,
0x2b01c4,
0x379d0d,
0x27dd02,
0x366a83,
0x37f183,
0x6b202482,
0x396d85,
0x21d947,
0x2c2784,
0x3c7c87,
0x352449,
0x2d4ac9,
0x204483,
0x285308,
0x35fd89,
0x240ac7,
0x383305,
0x3c7a06,
0x3d5fc6,
0x307705,
0x2e0105,
0x6b600fc2,
0x289bc5,
0x2c1748,
0x2ce446,
0x6ba02d87,
0x296e44,
0x2e8f47,
0x309d06,
0x6be2ce82,
0x350446,
0x30d9ca,
0x30e245,
0x6c2ef5c2,
0x6c625482,
0x322c46,
0x2c8448,
0x6ca9a507,
0x6ce01402,
0x2017c3,
0x26d286,
0x221344,
0x3c73c6,
0x202086,
0x26fd4a,
0x280845,
0x26d886,
0x2fe943,
0x2fe944,
0x2044c2,
0x334e83,
0x6d223682,
0x2f9703,
0x219484,
0x2c8584,
0x6d6c858a,
0x213383,
0x3c53ca,
0x2398c7,
0x313686,
0x260444,
0x256502,
0x2b0982,
0x6da04242,
0x234783,
0x25a947,
0x204247,
0x294504,
0x3af547,
0x2f8bc6,
0x229ac7,
0x30c204,
0x2b9645,
0x216b45,
0x6de16082,
0x21a946,
0x21cf83,
0x21d582,
0x21d586,
0x6e205202,
0x6e602b82,
0x3ad605,
0x6ea09702,
0x6ee048c2,
0x3518c5,
0x2d6745,
0x2b3405,
0x6f25f843,
0x24f6c5,
0x2ed947,
0x2faa45,
0x341f85,
0x330184,
0x307446,
0x3acb04,
0x6f604342,
0x702d9dc5,
0x396607,
0x27de48,
0x252346,
0x25234d,
0x252bc9,
0x252bd2,
0x3caa05,
0x30eb03,
0x70602d02,
0x3025c4,
0x21cec3,
0x30f885,
0x310e05,
0x70a5efc2,
0x25efc3,
0x70e5d882,
0x7161c182,
0x71a03b02,
0x2d27c5,
0x3c7dc3,
0x222908,
0x71e01142,
0x722073c2,
0x275c06,
0x351b0a,
0x21e843,
0x25cc83,
0x30f403,
0x73601882,
0x81a21c82,
0x82208c02,
0x206e42,
0x350249,
0x2d1184,
0x2b71c8,
0x82706c02,
0x82a02402,
0x2cf8c5,
0x234388,
0x362488,
0x2f314c,
0x239803,
0x82e26b82,
0x83208f02,
0x277d46,
0x314505,
0x27fe83,
0x2633c6,
0x314646,
0x208f03,
0x3b8843,
0x316246,
0x317d04,
0x278dc6,
0x21314a,
0x2977c4,
0x3183c4,
0x318b0a,
0x8365e7c2,
0x297945,
0x31c5ca,
0x31d085,
0x31d944,
0x31da46,
0x31dbc4,
0x214c86,
0x83a57a82,
0x257a86,
0x378185,
0x38c987,
0x395ac6,
0x260d04,
0x2e4d87,
0x349206,
0x23b1c5,
0x23b1c7,
0x3b9747,
0x3b974e,
0x255f86,
0x3cfd85,
0x20fc47,
0x20a383,
0x33f4c7,
0x20acc5,
0x220e44,
0x228742,
0x273507,
0x309c04,
0x241084,
0x246f4b,
0x2199c3,
0x29a8c7,
0x2199c4,
0x2c3487,
0x228003,
0x3560cd,
0x3a4a48,
0x229344,
0x2768c5,
0x31e105,
0x31e543,
0x83e1ffc2,
0x320b03,
0x321103,
0x21aac4,
0x28b785,
0x21d007,
0x2fe9c6,
0x392283,
0x237d4b,
0x27bacb,
0x2bd80b,
0x2dd34b,
0x2ef60a,
0x3392cb,
0x37308b,
0x39858c,
0x3d6b4b,
0x3d86d1,
0x32258a,
0x322dcb,
0x32308c,
0x32338b,
0x3249ca,
0x32500a,
0x32654e,
0x32714b,
0x32740a,
0x3295d1,
0x329a0a,
0x329f0b,
0x32a44e,
0x32afcc,
0x32bfcb,
0x32c28e,
0x32c60c,
0x32fc4a,
0x33114c,
0x8433144a,
0x332048,
0x332c09,
0x33838a,
0x33860a,
0x33888b,
0x340e8e,
0x342151,
0x34bac9,
0x34bd0a,
0x34c34b,
0x34e38a,
0x34ebd6,
0x34ff4b,
0x3508ca,
0x35120a,
0x352e0b,
0x353849,
0x356a49,
0x35708d,
0x35828b,
0x35968b,
0x35a04b,
0x35a509,
0x35ab4e,
0x35b40a,
0x35c98a,
0x35cfca,
0x35d8cb,
0x35e10b,
0x35ee0d,
0x360e4d,
0x361490,
0x36194b,
0x361f0c,
0x36268b,
0x36598b,
0x3674ce,
0x36858b,
0x36858d,
0x36bc4b,
0x36c6cf,
0x36ca8b,
0x36d2ca,
0x36d709,
0x36f449,
0x8476f7cb,
0x36fa8e,
0x370e8b,
0x371c4f,
0x37494b,
0x374c0b,
0x374ecb,
0x37560a,
0x37a049,
0x37d10f,
0x38178c,
0x381b8c,
0x38218e,
0x38288f,
0x382c4e,
0x383750,
0x383b4f,
0x38424e,
0x384a8c,
0x384d92,
0x385711,
0x385f0e,
0x38634e,
0x386c8b,
0x386c8e,
0x38700f,
0x3873ce,
0x387753,
0x387c11,
0x38804c,
0x38834e,
0x3887cc,
0x388d13,
0x38a250,
0x38d38c,
0x38d68c,
0x38db4b,
0x39034e,
0x39084b,
0x39148b,
0x39280c,
0x39788a,
0x397d8c,
0x39808c,
0x398389,
0x399acb,
0x399d88,
0x39a509,
0x39a50f,
0x39bc8b,
0x84b9c38a,
0x39d44c,
0x39e60b,
0x39e8c9,
0x39f488,
0x39fa4b,
0x3a028b,
0x3a11ca,
0x3a144b,
0x3a1a4c,
0x3a2348,
0x3a4d8b,
0x3a7acb,
0x3ab30e,
0x3ac80b,
0x3ae6cb,
0x3b92cb,
0x3b9589,
0x3b9acd,
0x3c81ca,
0x3cb2d7,
0x3cc698,
0x3d0449,
0x3d19cb,
0x3d20d4,
0x3d25cb,
0x3d2b4a,
0x3d300a,
0x3d328b,
0x3d3ad0,
0x3d3ed1,
0x3d48ca,
0x3d614d,
0x3d684d,
0x3d8b0b,
0x21aa43,
0x84f5b983,
0x2f1986,
0x241f45,
0x28bf87,
0x339186,
0x1662202,
0x31a589,
0x331cc4,
0x2ec8c8,
0x21a5c3,
0x302507,
0x202542,
0x2bb443,
0x852074c2,
0x2d5e06,
0x2d7544,
0x3485c4,
0x390243,
0x85ad2e42,
0x85eb5e44,
0x281e87,
0x86228702,
0x22cc43,
0x232ec3,
0x215e43,
0x20e403,
0x21c103,
0x201ac3,
0xf2248,
0x21ba03,
0x200742,
0xb2b48,
0x204502,
0x215e43,
0x20e403,
0x21c103,
0x1ba03,
0x201ac3,
0x203583,
0x347a16,
0x36a713,
0x3af3c9,
0x37c588,
0x38afc9,
0x31c746,
0x359290,
0x246453,
0x312ac8,
0x286207,
0x2894c7,
0x2addca,
0x32ce49,
0x3a24c9,
0x2480cb,
0x27e586,
0x294a4a,
0x21db86,
0x3318c3,
0x2e4385,
0x35bfc8,
0x26064d,
0x33bfcc,
0x306d47,
0x327bcd,
0x273304,
0x23048a,
0x230fca,
0x23148a,
0x20e6c7,
0x23ed47,
0x242504,
0x293486,
0x32de44,
0x2dab08,
0x2eeb89,
0x339906,
0x339908,
0x2fe64d,
0x2d4d09,
0x3167c8,
0x25d547,
0x2394ca,
0x253fc6,
0x2618c7,
0x2dbd84,
0x29a187,
0x215e4a,
0x23f10e,
0x229505,
0x29a08b,
0x307909,
0x224d49,
0x2b9d47,
0x3b780a,
0x39ed87,
0x300a09,
0x33d848,
0x218b8b,
0x2eb3c5,
0x30cb8a,
0x237ac9,
0x27fe0a,
0x2d7f0b,
0x3b8a8b,
0x247e55,
0x303205,
0x25d5c5,
0x2ffc8a,
0x27100a,
0x209947,
0x21e983,
0x2c0fc8,
0x2e228a,
0x2200c6,
0x26b549,
0x298508,
0x2ed6c4,
0x388ac9,
0x2cc6c8,
0x2c7c87,
0x2d9dc6,
0x396607,
0x329407,
0x241605,
0x22934c,
0x2768c5,
0x22cc43,
0x232ec3,
0x215e43,
0x21c103,
0x1ba03,
0x201ac3,
0x204502,
0x22cc43,
0x21c103,
0x21ba03,
0x201ac3,
0x22cc43,
0x21c103,
0x1ba03,
0x27d543,
0x201ac3,
0xb2b48,
0x22cc43,
0x232ec3,
0x215e43,
0x20e403,
0x21c103,
0x1ba03,
0x201ac3,
0xb2b48,
0x204502,
0x202a02,
0x312d42,
0x202282,
0x2009c2,
0x2099c2,
0x9e2c6,
0x4820f83,
0x94887,
0x101,
0x522cc43,
0x232ec3,
0x21fe83,
0x215e43,
0x213303,
0x20e403,
0x2e4286,
0x21c103,
0x201ac3,
0x234443,
0xb2b48,
0x281744,
0x209087,
0x390283,
0x320744,
0x206803,
0x293ac3,
0x215e43,
0x9a6c7,
0x80cc4,
0x6f4c3,
0x80205,
0x200742,
0x4dd03,
0x6604502,
0x6898309,
0x9898d,
0x98ccd,
0x312d42,
0x1f504,
0x80249,
0x200342,
0x6e1f408,
0xff404,
0xb2b48,
0x1409802,
0x1401582,
0x1409802,
0x151d2c6,
0x22f003,
0x2c3f43,
0x762cc43,
0x230484,
0x7a32ec3,
0x7e15e43,
0x205142,
0x21f504,
0x21c103,
0x30b7c3,
0x2052c2,
0x201ac3,
0x216942,
0x305ec3,
0x208a82,
0x26fb83,
0x276043,
0x2076c2,
0xb2b48,
0x22f003,
0x30b7c3,
0x2052c2,
0x305ec3,
0x208a82,
0x26fb83,
0x276043,
0x2076c2,
0x305ec3,
0x208a82,
0x26fb83,
0x276043,
0x2076c2,
0x22cc43,
0x24dd03,
0x22cc43,
0x232ec3,
0x215e43,
0x21f504,
0x213303,
0x20e403,
0x221904,
0x21c103,
0x201ac3,
0x200e42,
0x214903,
0xb2b48,
0x22cc43,
0x232ec3,
0x215e43,
0x20e403,
0x21c103,
0x201ac3,
0x24dd03,
0x204502,
0x22cc43,
0x232ec3,
0x215e43,
0x21f504,
0x21c103,
0x201ac3,
0x383305,
0x25efc2,
0x200742,
0xb2b48,
0x14975c8,
0x16ac0a,
0x215e43,
0x200001,
0x202701,
0x202741,
0x201f01,
0x201e81,
0x21db01,
0x208141,
0x20a2c1,
0x203a41,
0x203a81,
0x200101,
0x200301,
0xfe4c5,
0xb2b48,
0x200781,
0x200a81,
0x200041,
0x200141,
0x200a01,
0x200dc1,
0x200541,
0x2077c1,
0x2026c1,
0x200641,
0x200081,
0x2001c1,
0x200341,
0x200e41,
0x20bc41,
0x2002c1,
0x200c01,
0x200401,
0x200441,
0x202401,
0x202881,
0x209841,
0x200cc1,
0x201441,
0x22cc43,
0x232ec3,
0x215e43,
0x21c103,
0x201ac3,
0x204502,
0x22cc43,
0x232ec3,
0x200342,
0x201ac3,
0x9a6c7,
0xe507,
0x28906,
0x3adca,
0x96308,
0x59f88,
0x5a847,
0x86,
0xea205,
0x148e45,
0xdc886,
0x107146,
0x2056c4,
0x26ca47,
0xb2b48,
0x2e4e84,
0x22cc43,
0x232ec3,
0x215e43,
0x21c103,
0x201ac3,
0x22cc43,
0x232ec3,
0x215e43,
0x21c103,
0x201ac3,
0x331648,
0x2068c4,
0x232e04,
0x274a84,
0x277c47,
0x2e07c7,
0x22cc43,
0x23638b,
0x33ef8a,
0x27e847,
0x23ffc8,
0x38c288,
0x232ec3,
0x32d047,
0x21fe83,
0x3bf588,
0x3c1d09,
0x21f504,
0x213303,
0x23b788,
0x20e403,
0x2de24a,
0x2e4286,
0x3a5a07,
0x21c103,
0x21e886,
0x31e888,
0x201ac3,
0x282586,
0x2f620d,
0x2f8788,
0x30018b,
0x27cec6,
0x32f3c7,
0x223b85,
0x3be2ca,
0x222ac5,
0x24938a,
0x25efc2,
0x202903,
0x241084,
0x203a86,
0x3b1283,
0x2b2a43,
0x250bc3,
0x2068c3,
0x207783,
0x200582,
0x319fc5,
0x2b4589,
0x241c83,
0x229a43,
0x204883,
0x200301,
0x2d9687,
0x2d2505,
0x3851c3,
0x3bc883,
0x274a84,
0x27f043,
0x213088,
0x375183,
0x30bd8d,
0x256048,
0x385446,
0x334ec3,
0x397303,
0x3aca83,
0xbe2cc43,
0x232708,
0x236384,
0x2437c3,
0x203b86,
0x247648,
0x2046c3,
0x3be303,
0x205b03,
0x232ec3,
0x2242c3,
0x247f43,
0x2b0183,
0x334e43,
0x226543,
0x204b03,
0x39eac5,
0x255244,
0x256747,
0x233bc2,
0x259a43,
0x25cdc6,
0x25e643,
0x25eb83,
0x2852c3,
0x203903,
0x204a83,
0x2a3a47,
0xc215e43,
0x24f0c3,
0x3c2683,
0x219203,
0x21cc83,
0x257dc3,
0x35ba45,
0x377343,
0x24c909,
0x20d383,
0x311103,
0xc636983,
0x3a2283,
0x21f708,
0x2b44c6,
0x200706,
0x2a9686,
0x38a907,
0x21c2c3,
0x228c03,
0x20e403,
0x296406,
0x2055c2,
0x2ba883,
0x35ce85,
0x21c103,
0x25fa07,
0x161ba03,
0x244e03,
0x20e743,
0x20b083,
0x22c403,
0x201ac3,
0x20c746,
0x27ed86,
0x37d9c3,
0x22b7c3,
0x214903,
0x25e483,
0x3b88c3,
0x303c83,
0x306283,
0x20b745,
0x202ac3,
0x26a006,
0x32e048,
0x21e143,
0x377e49,
0x2b9308,
0x225608,
0x26aac5,
0x23b34a,
0x23d0ca,
0x23f74b,
0x23fb88,
0x306a43,
0x3923c3,
0x342083,
0x32b288,
0x381a43,
0x2fe944,
0x262343,
0x204243,
0x238d03,
0x257f43,
0x234443,
0x25efc2,
0x227ec3,
0x239803,
0x318583,
0x319544,
0x241084,
0x212f43,
0xb2b48,
0x200742,
0x200602,
0x200582,
0x203642,
0x203c82,
0x200782,
0x216f82,
0x201d42,
0x201382,
0x2000c2,
0x218ec2,
0x202c42,
0x2728c2,
0x208702,
0x2099c2,
0x2036c2,
0x20c982,
0x213282,
0x21c4c2,
0x202f82,
0x204102,
0x215242,
0x204c42,
0x203582,
0x200c02,
0x23c5c2,
0x2048c2,
0x742,
0x602,
0x582,
0x3642,
0x3c82,
0x782,
0x16f82,
0x1d42,
0x1382,
0xc2,
0x18ec2,
0x2c42,
0x728c2,
0x8702,
0x99c2,
0x36c2,
0xc982,
0x13282,
0x1c4c2,
0x2f82,
0x4102,
0x15242,
0x4c42,
0x3582,
0xc02,
0x3c5c2,
0x48c2,
0x22cc43,
0x232ec3,
0x215e43,
0x21c103,
0x201ac3,
0x2902,
0x22cc43,
0x232ec3,
0x215e43,
0x21c103,
0x201ac3,
0x4502,
0x204502,
0x201ac3,
0xde2cc43,
0x215e43,
0x20e403,
0x75003,
0x22e8c2,
0xb2b48,
0x22cc43,
0x232ec3,
0x215e43,
0x21c103,
0x75003,
0x201ac3,
0x74c2,
0x200942,
0x15b2885,
0x201c82,
0xb2b48,
0x4502,
0x235382,
0x200482,
0x206cc2,
0x20e342,
0x24ffc2,
0x148e45,
0x203542,
0x2052c2,
0x209342,
0x204902,
0x2036c2,
0x3a1b42,
0x211202,
0x227782,
0x9a6c7,
0xf54cd,
0xea289,
0xcb20b,
0xed808,
0x77289,
0x111b86,
0x215e43,
0xb2b48,
0x80cc4,
0x6f4c3,
0x80205,
0xb2b48,
0xe6fc7,
0x5b346,
0x80249,
0x16c4e,
0x1c2d87,
0x200742,
0x2056c4,
0x204502,
0x22cc43,
0x202a02,
0x232ec3,
0x201382,
0x2e4e84,
0x213303,
0x251402,
0x21c103,
0x200342,
0x201ac3,
0x25d5c6,
0x338e4f,
0x602883,
0xb2b48,
0x204502,
0x21fe83,
0x215e43,
0x20e403,
0x1ba03,
0x16c48,
0x15be08b,
0x152e7ca,
0x1477107,
0xade8b,
0x10eb85,
0xfe4c5,
0x9a6c7,
0x204502,
0x22cc43,
0x215e43,
0x21c103,
0x200742,
0x206d42,
0x3447c2,
0x1162cc43,
0x2401c2,
0x232ec3,
0x20d342,
0x209542,
0x215e43,
0x24cc42,
0x276b82,
0x2b5e02,
0x203602,
0x29e002,
0x204282,
0x200dc2,
0x25fec2,
0x2882c2,
0x206d82,
0x5904c,
0x2bd542,
0x2f6782,
0x21cfc2,
0x24d382,
0x20e403,
0x208302,
0x21c103,
0x215f82,
0x2dd302,
0x201ac3,
0x241d02,
0x203582,
0x2085c2,
0x2062c2,
0x20d202,
0x2ef5c2,
0x216082,
0x25d882,
0x21d6c2,
0x32740a,
0x36d2ca,
0x39ca0a,
0x3d9582,
0x201e02,
0x35ba02,
0x11b34009,
0x11fc8eca,
0x142e2c7,
0x12202942,
0x140a803,
0x7e02,
0x1c8eca,
0x192ace,
0x24fc04,
0x12a2cc43,
0x232ec3,
0x251344,
0x1b8786,
0x215e43,
0x21f504,
0x213303,
0x148109,
0x2f306,
0x20e403,
0xee044,
0x1e43,
0x21c103,
0x24a85,
0x21ba03,
0x201ac3,
0x1507504,
0x202ac3,
0x202903,
0xb2b48,
0x27c6,
0x1400004,
0x190045,
0x1c2b4a,
0x1310c2,
0x1c6846,
0x1c38d1,
0x13334009,
0x1900c8,
0x50688,
0x10a847,
0x282,
0xfe4cb,
0x18b40b,
0x17c00a,
0x9498a,
0x163b47,
0xb2b48,
0x11fa48,
0x1d1c47,
0x19c14e0b,
0x17c07,
0x4c2,
0x2b347,
0x15458a,
0xe58f,
0x42a0f,
0x192ac2,
0x4502,
0xb00c8,
0xf02ca,
0xe6aca,
0x8c84a,
0x55e48,
0xc448,
0x5f2c8,
0xe6f88,
0x7a48,
0x46c2,
0x1b290f,
0xac44b,
0x97fc8,
0x35687,
0x886ca,
0x1c96cb,
0x4ba49,
0x885c7,
0xc348,
0x3d28c,
0x13e0c7,
0x6860a,
0x5c248,
0x2890e,
0x290ce,
0x16398b,
0x37fcb,
0x6a78b,
0x73809,
0x73e4b,
0x1cf84d,
0x11b00b,
0x104a8d,
0x104e0d,
0x106f8a,
0x40ecb,
0x4794b,
0x4c145,
0x1a021050,
0xbccf,
0x13d1cf,
0x7988d,
0x86c90,
0x10ac2,
0x1a7635c8,
0xe388,
0x96f10,
0x1621ce,
0x1ab75145,
0x5048b,
0x147210,
0x58d48,
0xc54a,
0x38189,
0x66f47,
0x67287,
0x67447,
0x677c7,
0x69087,
0x69687,
0x6ad07,
0x6b247,
0x6b8c7,
0x6bbc7,
0x6c287,
0x6c447,
0x6c607,
0x6c7c7,
0x703c7,
0x70787,
0x71287,
0x71647,
0x71c87,
0x71f47,
0x72107,
0x72407,
0x72787,
0x72987,
0x743c7,
0x74587,
0x74747,
0x75387,
0x75887,
0x76487,
0x77687,
0x78147,
0x7a087,
0x7a247,
0x7a647,
0x7ab47,
0x7b047,
0x7b5c7,
0x7b787,
0x7b947,
0x81c87,
0x82707,
0x82c47,
0x83207,
0x833c7,
0x83747,
0x83d47,
0x1282,
0x5f3ca,
0xee187,
0x6e745,
0xa7d51,
0xa946,
0xfa00a,
0xaff4a,
0x5b346,
0x1b6ecb,
0x40c2,
0x2fad1,
0x198f89,
0xa2e49,
0x5fec2,
0xad5ca,
0xb3a89,
0xb41cf,
0xb47ce,
0xb5508,
0x58e82,
0x549,
0x1a730e,
0x14b7cc,
0xf074f,
0x1b19ce,
0x79d8c,
0x3a3c9,
0x3d691,
0x3dc48,
0x448d2,
0x4908d,
0x19f14d,
0x4f4cb,
0x50855,
0x7acc9,
0x8e50a,
0x92249,
0x184690,
0x1d460b,
0x9ff8f,
0xa074b,
0xacf8c,
0xb0390,
0xb758a,
0xba74d,
0xbae4e,
0xcaeca,
0xcf4cc,
0x1290d4,
0x198c11,
0x1c9e0b,
0xc0b4f,
0xc254d,
0xc2dce,
0xc7b4c,
0xc808c,
0xcabcb,
0xccd8e,
0xcd590,
0xce10b,
0xceb0d,
0x157b8f,
0x120d0c,
0x13978e,
0xd6e51,
0xda88c,
0xe7a07,
0xe880d,
0xed08c,
0xfc910,
0x108f8d,
0x109e47,
0x1662d0,
0x175848,
0x1930cb,
0xbbf0f,
0x43448,
0xfa20d,
0x10e2d0,
0x1af7c9,
0x1aebe246,
0xbf143,
0xc3385,
0x53a82,
0x88b49,
0x5c04a,
0x1b2f72c4,
0x119586,
0x1a4ca,
0x10548d,
0x1b53fa89,
0x21983,
0xf2f8a,
0xe5111,
0xe5549,
0xe6a47,
0xe7748,
0xe7bc7,
0xee248,
0x1b2a0b,
0x133489,
0xef890,
0xefd4c,
0xf0c08,
0xf0fc5,
0xf108,
0x1ba90a,
0x21a47,
0x6ce47,
0x2fc2,
0x147f0a,
0x871c9,
0x7aa05,
0x5f88a,
0x9a44f,
0x1301cb,
0x15bb0c,
0x148212,
0xdc9c5,
0xf25c8,
0x5554a,
0x1bafdbc5,
0x15b70c,
0x144603,
0x1a1b42,
0x10640a,
0x150678c,
0x13e448,
0x104c48,
0x140007,
0x1202,
0x8a82,
0x54150,
0x78687,
0x2edcf,
0xdc886,
0x8a84e,
0x16de4b,
0x4ed08,
0x4be09,
0x5a12,
0x11668d,
0x116bc8,
0xcb0c9,
0xdfdcd,
0x1c4e09,
0x19b60b,
0x1c1048,
0x89cc8,
0x8ab88,
0x8cd49,
0x8cf4a,
0x92f8c,
0xfff0a,
0x1b8907,
0x3c5cd,
0x1bec30c6,
0x10820b,
0x131acc,
0x110388,
0x49e89,
0x1c6a50,
0x73c2,
0x8c0cd,
0x1882,
0x21c82,
0x1b884a,
0xf9f0a,
0x10240b,
0x47b0c,
0x11f24c,
0x11f54a,
0x11f7ce,
0x1ab8d,
0x1c1d9445,
0x59788,
0x74c2,
0x13609ece,
0x13e7004e,
0x14607eca,
0x14f8fd0e,
0x1560fe4e,
0x15f7848c,
0x142e2c7,
0x142e2c9,
0x140a803,
0x1678d08c,
0x16e10ac9,
0x17626fc9,
0x17e4a449,
0x7e02,
0x9e11,
0x6ff91,
0x7e0d,
0x18fc51,
0x6f0d1,
0x1783cf,
0x18cfcf,
0x14d54c,
0x26f0c,
0x4a38c,
0xe1ecd,
0xfecd5,
0x152b0c,
0x15c68c,
0x170110,
0x1ad98c,
0x1d1dcc,
0x1d7899,
0x1d8e19,
0xfb99,
0x10814,
0x118d4,
0x15554,
0x16414,
0x171d4,
0x18611b89,
0x18c15809,
0x1975c749,
0x13a3de49,
0x7e02,
0x1423de49,
0x7e02,
0xfb8a,
0x7e02,
0x14a3de49,
0x7e02,
0xfb8a,
0x7e02,
0x1523de49,
0x7e02,
0x15a3de49,
0x7e02,
0x1623de49,
0x7e02,
0xfb8a,
0x7e02,
0x16a3de49,
0x7e02,
0xfb8a,
0x7e02,
0x1723de49,
0x7e02,
0x17a3de49,
0x7e02,
0xfb8a,
0x7e02,
0x1823de49,
0x7e02,
0xfb8a,
0x7e02,
0x18a3de49,
0x7e02,
0x1923de49,
0x7e02,
0x19a3de49,
0x7e02,
0xfb8a,
0x7e02,
0x1c38c5,
0x17c004,
0x9ece,
0x7004e,
0x12bc4e,
0x7eca,
0x18fd0e,
0xfe4e,
0x17848c,
0x18d08c,
0x10ac9,
0x26fc9,
0x4a449,
0x11b89,
0x15809,
0x15c749,
0xfeecd,
0x166c9,
0x17489,
0x12fb44,
0x1349c4,
0x1c2a84,
0x59944,
0xae144,
0x36b84,
0x3ab04,
0x59cc4,
0x10a844,
0x15a16c3,
0x3643,
0x10ac2,
0x1ab83,
0x9d003,
0x1513c2,
0x1cbb48,
0x133507,
0x46c2,
0x200742,
0x204502,
0x202a02,
0x21cd02,
0x201382,
0x200342,
0x208a82,
0x22cc43,
0x232ec3,
0x215e43,
0x21cc83,
0x21c103,
0x201ac3,
0xb2b48,
0x22cc43,
0x232ec3,
0x21c103,
0x201ac3,
0xb343,
0x215e43,
0x1f504,
0x200742,
0x24dd03,
0x1e62cc43,
0x211747,
0x215e43,
0x223643,
0x221904,
0x21c103,
0x201ac3,
0x21a70a,
0x25d5c5,
0x214903,
0x202b82,
0xb2b48,
0xb2b48,
0x4502,
0x1424c2,
0x1ef3f80b,
0x1f22cd04,
0xf7205,
0xe585,
0x1d6e86,
0x1f60e585,
0x58383,
0x166a43,
0x80cc4,
0x6f4c3,
0x80205,
0xfe4c5,
0xb2b48,
0x17c07,
0x2cc43,
0x1fe3ac07,
0x6186,
0x20007d05,
0x6247,
0xcd4a,
0x1a96c8,
0xcc47,
0x6aeca,
0x169988,
0x33407,
0x9a8f,
0x4b347,
0x59ac6,
0x147210,
0x1450cf,
0xf989,
0x119604,
0x2040630e,
0x39cc9,
0x6c906,
0x10d789,
0x1922c6,
0x137e46,
0xee70c,
0x1c98ca,
0x4bbc7,
0x18ee0a,
0x7fc09,
0x8684c,
0x1bf8a,
0x4caca,
0x80249,
0x119586,
0x4bc8a,
0x1177ca,
0xa5c4a,
0x15b1c9,
0xe4a48,
0xe4cc6,
0xea80d,
0xc3a05,
0x20b5f60c,
0x1c2d87,
0x10b3c9,
0x25487,
0xbdd54,
0x10e6cb,
0x97e0a,
0x588a,
0xb080d,
0x1502609,
0x11644c,
0x1169cb,
0x9583,
0x9583,
0x28906,
0x9583,
0x1d6e88,
0x1c7e03,
0x121189,
0x4dd03,
0xb2b48,
0x4502,
0x51344,
0xc0303,
0x183305,
0x22cc43,
0x232ec3,
0x215e43,
0x21c103,
0x201ac3,
0x229a43,
0x22cc43,
0x232ec3,
0x21fe83,
0x215e43,
0x20e403,
0x21c103,
0x201ac3,
0x2a3003,
0x202903,
0x229a43,
0x2056c4,
0x22cc43,
0x232ec3,
0x215e43,
0x21c103,
0x201ac3,
0x231303,
0x229b2c85,
0x142aa43,
0x22cc43,
0x232ec3,
0x21cd03,
0x21fe83,
0x215e43,
0x21f504,
0x2026c3,
0x228c03,
0x20e403,
0x21c103,
0x201ac3,
0x214903,
0x4502,
0x26d2c3,
0x23a2cc43,
0x232ec3,
0x24c043,
0x215e43,
0x225883,
0x228c03,
0x201ac3,
0x213283,
0x351dc4,
0xb2b48,
0x2422cc43,
0x232ec3,
0x2b55c3,
0x215e43,
0x20e403,
0x221904,
0x21c103,
0x201ac3,
0x21ea03,
0xb2b48,
0x24a2cc43,
0x232ec3,
0x21fe83,
0x21ba03,
0x201ac3,
0xb2b48,
0x142e2c7,
0x24dd03,
0x22cc43,
0x232ec3,
0x215e43,
0x21f504,
0x221904,
0x21c103,
0x201ac3,
0xfe4c5,
0x9a6c7,
0xbdf8b,
0xe5944,
0xc3a05,
0x14975c8,
0xb5c0d,
0x25f075c5,
0xa7ec4,
0x4502,
0x8783,
0x1af6c5,
0x27e745,
0xb2b48,
0x7842,
0x1a103,
0x4502,
0x102e86,
0x3321c8,
0x397187,
0x2056c4,
0x33f1c6,
0x34d406,
0xb2b48,
0x326843,
0x33cbc9,
0x326995,
0x12699f,
0x22cc43,
0x2e1a92,
0x181e46,
0x183ec5,
0xc54a,
0x38189,
0x2e184f,
0x2e4e84,
0x218f05,
0x310ed0,
0x37c787,
0x21ba03,
0x244e08,
0x16ab46,
0x29d84a,
0x202e44,
0x2fd603,
0x25d5c6,
0x202b82,
0x2f6fcb,
0x1ba03,
0x19fcc4,
0x22cc43,
0x232ec3,
0x215e43,
0x20e403,
0x21c103,
0x1ba03,
0x201ac3,
0x3040c3,
0x204502,
0xeed43,
0x21c103,
0x201ac3,
0x22cc43,
0x232ec3,
0x215e43,
0x20e403,
0x201ac3,
0x22cc43,
0x232ec3,
0x215e43,
0x223643,
0x237ac3,
0x201ac3,
0x204502,
0x22cc43,
0x232ec3,
0x21c103,
0x1ba03,
0x201ac3,
0x200742,
0x22cc43,
0x232ec3,
0x215e43,
0x21c103,
0x201ac3,
0xe585,
0x2056c4,
0x22cc43,
0x232ec3,
0x21af04,
0x21c103,
0x201ac3,
0xb2b48,
0x22cc43,
0x232ec3,
0x215e43,
0x21c103,
0x75003,
0x201ac3,
0x22cc43,
0x232ec3,
0x21fe83,
0x219203,
0x20e403,
0x21c103,
0x1ba03,
0x201ac3,
0x22cc43,
0x232ec3,
0x215e43,
0x32cdc4,
0x21f504,
0x21c103,
0x201ac3,
0x202903,
0x204502,
0x22cc43,
0x232ec3,
0x215e43,
0x21c103,
0x75003,
0x201ac3,
0xb2b48,
0x22cc43,
0x232ec3,
0x215e43,
0x33c583,
0x6b0c3,
0x23643,
0x21c103,
0x201ac3,
0x32740a,
0x34e989,
0x36604b,
0x366b4a,
0x36d2ca,
0x37b54b,
0x39208a,
0x39788a,
0x39ca0a,
0x39cc8b,
0x3ba649,
0x3c4aca,
0x3c604b,
0x3d288b,
0x3d848a,
0x22cc43,
0x232ec3,
0x21fe83,
0x20e403,
0x21c103,
0x1ba03,
0x201ac3,
0xeb4b,
0x602c8,
0xdff04,
0x1b2b46,
0x107249,
0xb2b48,
0x22cc43,
0x266f44,
0x2089c2,
0x221904,
0x280745,
0x229a43,
0x2056c4,
0x22cc43,
0x236384,
0x232ec3,
0x251344,
0x2e4e84,
0x21f504,
0x228c03,
0x21c103,
0x201ac3,
0x28c285,
0x231303,
0x214903,
0x27be03,
0x2769c4,
0x202744,
0x321445,
0xb2b48,
0x2087c4,
0x337fc6,
0x280384,
0x204502,
0x24ac07,
0x253b87,
0x24f1c4,
0x25df45,
0x309185,
0x22e005,
0x21f504,
0x38a9c8,
0x235bc6,
0x325908,
0x288305,
0x2eb3c5,
0x315dc4,
0x201ac3,
0x2ff404,
0x37a386,
0x25d6c3,
0x2769c4,
0x249485,
0x288ac4,
0x23c404,
0x202b82,
0x22ae86,
0x3af0c6,
0x314505,
0x200742,
0x24dd03,
0x2d604502,
0x363744,
0x201382,
0x20e403,
0x29f502,
0x21c103,
0x200342,
0x2fab86,
0x203583,
0x202903,
0xb5e44,
0xb2b48,
0xb2b48,
0x215e43,
0x75003,
0x200742,
0x2e204502,
0x215e43,
0x26c583,
0x2026c3,
0x22cd04,
0x21c103,
0x201ac3,
0xb2b48,
0x200742,
0x2ea04502,
0x22cc43,
0x21c103,
0x1ba03,
0x201ac3,
0x4102,
0x202d02,
0x25efc2,
0x223643,
0x2f5d43,
0x200742,
0xfe4c5,
0xb2b48,
0x9a6c7,
0x204502,
0x232ec3,
0x251344,
0x212503,
0x215e43,
0x219203,
0x20e403,
0x21c103,
0x201bc3,
0x201ac3,
0x21e983,
0x7bd53,
0xe13d4,
0xfe4c5,
0x9a6c7,
0x10bcc6,
0x112fcb,
0x28906,
0x59dc7,
0x5df46,
0x40c9,
0xdd90a,
0x961cd,
0xf51cc,
0x11814a,
0x15fc08,
0x148e45,
0xcd88,
0xdc886,
0x76606,
0x107146,
0x210ac2,
0x3984,
0x9d006,
0xe890,
0x8ecce,
0x7d6cc,
0xfe4c5,
0x17c1c7,
0x1ff11,
0x10a6ca,
0x22cc43,
0x6ae45,
0x1b8dc8,
0x16284,
0x2fc26846,
0xa7d46,
0xd6206,
0x9e2ca,
0x185203,
0x30246404,
0x4085,
0x106f03,
0x30634607,
0x24a85,
0x1b6f8c,
0x1019c8,
0x2b48b,
0x75e8b,
0x30a4c5cc,
0x141dac3,
0xc4a48,
0x2b705,
0xac2c9,
0x102708,
0x141a406,
0x94887,
0x30f89249,
0x126047,
0x10eb8a,
0xa388,
0x1d6e88,
0x10a844,
0x153705,
0x75fc7,
0x31275fc3,
0x3167dc86,
0x31affc84,
0x31f065c7,
0x1d6e84,
0x1d6e84,
0x1d6e84,
0x1d6e84,
0x22cc43,
0x232ec3,
0x215e43,
0x20e403,
0x21c103,
0x201ac3,
0x200742,
0x204502,
0x215e43,
0x205142,
0x21c103,
0x201ac3,
0x203583,
0x38288f,
0x382c4e,
0xb2b48,
0x22cc43,
0x47487,
0x232ec3,
0x215e43,
0x213303,
0x21c103,
0x201ac3,
0x8104,
0x6f604,
0x817c4,
0x208b43,
0x208b47,
0x204e82,
0x2f3ec9,
0x200602,
0x25444b,
0x2b2f4a,
0x27c5c9,
0x200182,
0x377f86,
0x22d355,
0x254595,
0x2320d3,
0x254b13,
0x206fc2,
0x206fc5,
0x206fcc,
0x28298b,
0x2bd205,
0x203642,
0x306242,
0x3951c6,
0x200282,
0x262586,
0x20c7cd,
0x239f4c,
0x2210c4,
0x201782,
0x206e02,
0x244c88,
0x203c82,
0x225986,
0x22598f,
0x32b410,
0x33ac84,
0x22d515,
0x232253,
0x205683,
0x33368a,
0x21e747,
0x351709,
0x2edd47,
0x329902,
0x200882,
0x39cf06,
0x26f782,
0xb2b48,
0x206ac2,
0x200302,
0x20ad87,
0x27c3c7,
0x27c3d1,
0x216905,
0x21690e,
0x2176cf,
0x2004c2,
0x21e947,
0x219e48,
0x2064c2,
0x21c002,
0x2a1046,
0x32f5cf,
0x2a1050,
0x22a242,
0x205382,
0x32dec8,
0x208e43,
0x2c0488,
0x2f12cd,
0x205543,
0x287608,
0x2517cf,
0x251b8e,
0x20554a,
0x3c55d1,
0x3c5a50,
0x2c60cd,
0x2c640c,
0x26d147,
0x333807,
0x33f289,
0x201c42,
0x200782,
0x25bb0c,
0x25be0b,
0x200d82,
0x2cad86,
0x201542,
0x203f02,
0x392ac2,
0x204502,
0x22da44,
0x23a787,
0x233782,
0x241747,
0x244087,
0x22b6c2,
0x202b42,
0x247345,
0x201482,
0x2d9b0e,
0x39638d,
0x232ec3,
0x3ce90e,
0x2ca64d,
0x32f343,